KEGG   Oryzias latipes (Japanese medaka): 101155917Help
Entry
101155917         CDS       T02443                                 

Definition
(RefSeq) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00730  Thiamine metabolism
ola00790  Folate biosynthesis
ola01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    101155917
   00790 Folate biosynthesis
    101155917
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ola04147]
    101155917
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ola00537]
    101155917
Enzymes [BR:ola01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     101155917
Exosome [BR:ola04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101155917
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ola00537]
 Enzymes
  101155917
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme DBI_PRT
Motif
Other DBs
NCBI-GeneID: 101155917
NCBI-ProteinID: XP_023809973
LinkDB All DBs
Position
4
AA seq 538 aa AA seqDB search
MLVAHFWALNLQIFLLGPILKVASMATMETRAALHEIEKEPAYWNAQAKAALNAALKLHP
RHHRAKNLILFLGDGMGVTTVSAARILRGQMEGWSGEETVLAMDTFPYVALSKTYSVDKQ
VADSASTATAYHCGVKANAKTLGLNAKAVVYECNTTFGNEVHSVLRRAKAQGKSVGIVTT
TRVQHASPAAAYAHSVSRKWYSDADLPSSAIQQGCVDIATQLVTNVDIDVILGGGRMYMT
PQGTPDPEYPTSSSRKGDRKDKRNLINIWLKAKPKKKSHYVWNKKGFDEINVKTTDRLMG
LFEPKDMKFEVYRNSSSDPSIVEMTEKAIQILRKNPKGYFLFVEGGRIDHGHHDNTAKLA
LRETVMFDAAIERAGQLTRESDTLTVVTADHSHVFTFGGSTPRGNPIFGLAPKDAMDKMP
FTSILYANGPGYEHANGSRDNITMVDYEDDEYKQQAAVPLEAETHGGEDVAIYAKGPMAH
LFHGVKEQNYVAHVMAYAACLEPYTSCPPRPLNRSSAGCGKLHLGLLFSMFGLLLLLR
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgctggtggcacatttttgggccctcaatcttcagattttccttctgggccccatccta
aaggttgcaagcatggcaactatggagactcgagcggctctgcatgaaattgagaaggag
ccagcctactggaatgcacaagcaaaggcagccctgaatgctgccctgaagctccatcct
cgacaccacagggctaaaaacctcatcctgtttctaggagatggaatgggtgtgaccaca
gtatcagcagctcgaatcctaagaggtcagatggagggttggtctggagaggaaacagtg
ctggccatggacaccttcccctatgttgccctttctaagacctacagtgtagacaagcag
gtagcagacagtgccagcacggctacagcttatcactgtggggtaaaggccaatgccaaa
accctaggacttaatgcaaaagctgtggtctacgagtgcaacaccacttttggcaacgag
gtgcactcagtgctgcgacgtgcaaaagcacaaggtaaatcagtgggcattgtgacaacc
acacgtgtccagcacgcatccccagctgctgcttacgcccattctgtcagccgcaagtgg
tacagcgatgcagatcttccttccagtgccatccagcagggttgtgtcgacattgctaca
caactggtcaccaatgtagacattgatgtgattttgggaggaggaaggatgtacatgaca
cctcaaggaaccccagatcccgaatatcctacctcatcgtcccgcaaaggggaccgcaaa
gacaaaagaaacctcataaatatctggctgaaggccaaacctaaaaaaaaatcccactac
gtctggaacaagaagggattcgatgaaataaatgtcaaaacaacagatcgtcttatgggc
ctttttgagccaaaggacatgaaatttgaagtttatcgaaatagctcaagtgatccatca
attgtggaaatgacagaaaaggccattcaaatcctcaggaagaatccaaaaggctatttt
ctgtttgtggaaggagggagaatcgatcatggccaccatgacaacactgcaaaactggct
ctcagggagactgtaatgtttgatgcagctattgagcgagctggacagctcaccagagag
tctgacacactgacagtagtgactgctgaccactcacatgtcttcacttttggaggcagc
acacctcgaggaaatcccatctttggtttggcaccaaaggacgccatggacaaaatgcct
ttcactagcattctttatgccaatggccccggatatgagcatgccaatggaagcagagac
aacatcacaatggtggattatgaagatgacgagtacaagcagcaggcagctgtccctttg
gaagcagagacacatggtggggaggatgttgccatctatgccaaaggcccaatggctcac
ttgtttcatggagttaaggagcaaaactatgttgctcatgtgatggcctatgctgcctgt
ttggagccatataccagctgccctcctcgccccctcaaccgttcatcagcaggatgcggg
aaattgcatctgggtctcttatttagcatgtttggtctcctcctgctgctcagatga

DBGET integrated database retrieval system