KEGG   Oryzias latipes (Japanese medaka): 101155925
Entry
101155925         CDS       T02443                                 

Gene name
siah1
Definition
(RefSeq) E3 ubiquitin-protein ligase SIAH1 isoform X2
  KO
K04506  E3 ubiquitin-protein ligase SIAH1 [EC:2.3.2.27]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
ola04120  Ubiquitin mediated proteolysis
ola04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101155925 (siah1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101155925 (siah1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    101155925 (siah1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ola04121]
    101155925 (siah1)
Enzymes [BR:ola01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     101155925 (siah1)
Ubiquitin system [BR:ola04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   SINA (Seven in absentia) proteins
    101155925 (siah1)
SSDB
Motif
Pfam: Sina
Other DBs
NCBI-GeneID: 101155925
NCBI-ProteinID: XP_004069806
UniProt: A0A3P9L666 H2MEL0
LinkDB
Position
6
AA seq 286 aa
MDEEMSRQTATALPTGTSKCPPSQRVPTLSGTTASNSDLASLFECPVCFDYVLPPILQCQ
SGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEVTLPHTDKTE
HEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAV
DWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTW
EATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC
NT seq 861 nt   +upstreamnt  +downstreamnt
atggacgaagaaatgagtcgccagaccgccaccgcgctgcccactggaacatccaagtgc
cccccctctcagcgcgtgcccaccctgtcgggcaccaccgcctccaacagtgacctggcc
agcctgttcgagtgtcccgtctgcttcgactatgtcctgccccccatcctccagtgccag
tcgggacacctggtgtgctccaactgtcggcccaaactcacctgctgccccacctgcaga
ggcccgctgggctccatcaggaacctggccatggagaaggtggccaactccgtcctcttt
ccctgcaagtacgcctcgtcaggctgcgaggtcacgctcccccacaccgacaagacggag
cacgaggagctgtgcgagttccgaccgtactcctgcccctgtcccggcgcctcctgcaag
tggcagggctccctggacgccgtgatgcctcacctgatgcatcagcacaagtccatcacc
accctgcagggggaggacatcgtgttcctggcgacagacatcaacctgcccggcgccgtg
gactgggtcatgatgcagtcctgctttggcttccacttcatgctggtcctggagaagcag
gaaaagtacgatggacatcagcagtttttcgccatcgtccagctcattgggacccggaag
caggccgagaactttgcataccggctggagctgaacgggcaccggcgccggctgacctgg
gaggccacgccgcgctccatccacgagggcatcgccaccgccatcatgaacagcgactgc
ctggtgttcgacacgtcgatcgcgcagctgtttgcagagaacggaaacctgggcattaac
gtcaccatctccatgtgctaa

DBGET integrated database retrieval system