KEGG   Oryzias latipes (Japanese medaka): 101156312
Entry
101156312         CDS       T02443                                 

Definition
(RefSeq) CD82 antigen
  KO
K06509  CD82 antigen
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    101156312
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ola04147]
    101156312
   04090 CD molecules [BR:ola04090]
    101156312
Exosome [BR:ola04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101156312
  Exosomal proteins of other body fluids (saliva and urine)
   101156312
  Exosomal proteins of colorectal cancer cells
   101156312
CD molecules [BR:ola04090]
 Proteins
  101156312
SSDB
Motif
Pfam: Tetraspanin DUF1310 TrbI_Ftype
Other DBs
NCBI-GeneID: 101156312
NCBI-ProteinID: XP_023807938
LinkDB
Position
3
AA seq 254 aa
MGTGCMTASKYFLFLLNLIFFLLGGVILGFGLWLLLDNQSFIVIINNSTDVKVACYVLIS
VGAFSMLLGLFGCLGAIFQIKCLLGLYFTCLLVILVAQIAAGVLVYLQKEKVNEQMSKIV
DKVLGSYAGNSSRTEQAWDLIQKKMQCCGWMGQEDWNNNAVILNSSQLLFPCSCQNLTLT
VQNRSDSGFCEAQTPDWPVYNVGCSASVENWLITNIGVVLGICLTVALIELLGMILSICL
CRNVGTDYSKVPRF
NT seq 765 nt   +upstreamnt  +downstreamnt
atggggaccgggtgcatgacagccagcaagtacttcctgttcctcctcaacctcatcttc
tttcttttgggaggcgttatcttgggttttggactttggctcctcctggacaatcaaagc
ttcatcgtcatcatcaataactcaacagacgtgaaagtggcgtgctatgtcctcatcagc
gtcggagctttctccatgctccttggtttatttggctgccttggggccattttccagatc
aagtgcctgctaggattgtattttacctgcctcctggtgatccttgttgctcagattgca
gccggcgttctcgtgtacctgcagaaggagaaggtgaatgagcagatgtccaagattgtc
gacaaggtgctgggcagctatgcaggaaacagctccaggactgagcaggcctgggactta
atccagaagaagatgcagtgttgtggctggatggggcaggaggactggaacaataatgcc
gtcatcctcaacagctcccagttgctgtttccctgctcctgccagaacctcaccctgacc
gttcagaacagatctgacagcggcttctgcgaggcgcagacgcccgactggcctgtctac
aatgtgggatgttctgccagcgtggagaactggctcatcaccaacatcggggttgtcctg
gggatctgtctgacagtggctttgattgagctgctggggatgattctgtccatctgcttg
tgcagaaacgtcggcactgattacagcaaagtgcccagattctga

KEGG   Oryzias latipes (Japanese medaka): 101163200
Entry
101163200         CDS       T02443                                 

Definition
(RefSeq) CD82 antigen
  KO
K06509  CD82 antigen
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    101163200
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ola04147]
    101163200
   04090 CD molecules [BR:ola04090]
    101163200
Exosome [BR:ola04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101163200
  Exosomal proteins of other body fluids (saliva and urine)
   101163200
  Exosomal proteins of colorectal cancer cells
   101163200
CD molecules [BR:ola04090]
 Proteins
  101163200
SSDB
Motif
Pfam: Tetraspanin DUF2518
Other DBs
NCBI-GeneID: 101163200
NCBI-ProteinID: XP_004078469
LinkDB
Position
16
AA seq 361 aa
MRKWTLILETEHKTSTHDCEEEHPSPSSAAPPHQPNAMKLEVKIELLKFFFTFLNTLFLV
LGLSVGGCAIWILLGSGSFLNVLSSDELQVVAMGLLLIGAVVILVSLVGCIGSSSENRFM
LVVYGSFLIVLVLGQLFVMLLLLINRGKINQALTETVHKIISDYGNSSDIEERMMDAMQK
TGRCCGLTRASDWLENSFLQTLNLSTVDVLPCSCYASYNLTFNSSWCSENPELHSASVGE
GVHAFNESCSGKLSFWLQENILTIISMDVILLLLQMIDVAMAAALYQMFGKKATLKRNNQ
LFDESQDSDAESEDDGQHTYAYVHPDGEEPELNQTNHVNPNQQARFVHRAEPPGPWAFRD
Q
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgaggaagtggactttgatcctggagacagagcacaaaacctccacacacgactgcgag
gaagaacatccgagtccttcatctgctgctcctcctcatcagccaaacgccatgaagctg
gaggtgaagatcgagctgctgaagttcttcttcaccttcctgaacacgctcttcttggtt
ctgggtctgagtgttggcggctgtgctatctggattctgctcggctcaggaagcttcctg
aatgttctctcatctgatgaactgcaggtggtggcgatggggctcctcctgatcggggcg
gtggtgatcttggtcagcctcgttggatgcatcggatcaagcagcgagaacagattcatg
ctggtggtgtacggcagcttcctcatcgtcctggttctgggtcagctcttcgtcatgctg
ctgctgctcatcaacaggggcaagataaaccaggctttgactgaaactgttcataagatc
atctctgactatggaaacagcagtgacattgaggaaaggatgatggacgccatgcagaag
acgggacgttgctgtggtctgacacgagcctccgactggctggaaaactccttcctacag
acgttgaacctgtcaactgtggacgtcctcccatgttcctgttatgcatcatataatctc
acttttaactcgtcttggtgctcagagaacccagaacttcattcagcatctgttggagaa
ggagtccatgcttttaatgagagctgcagtggaaagctctcgttctggctgcaggagaac
atcctgaccatcatcagcatggatgtcatcctgctcctgctccagatgattgatgttgcc
atggcagcggctctgtaccaaatgtttgggaagaaagcgactctaaagagaaacaaccaa
ctttttgatgaaagccaagacagcgatgcggagtctgaagacgacggacagcatacttat
gcctatgtacatccagacggggaagaacccgagctcaaccaaaccaaccatgtcaacccg
aaccaacaggcccgctttgtccacagggcagaacccccggggccctgggcctttagggac
cagtaa

KEGG   Oryzias latipes (Japanese medaka): 101168284
Entry
101168284         CDS       T02443                                 

Gene name
cd82
Definition
(RefSeq) CD82 antigen isoform X1
  KO
K06509  CD82 antigen
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    101168284 (cd82)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ola04147]
    101168284 (cd82)
   04090 CD molecules [BR:ola04090]
    101168284 (cd82)
Exosome [BR:ola04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101168284 (cd82)
  Exosomal proteins of other body fluids (saliva and urine)
   101168284 (cd82)
  Exosomal proteins of colorectal cancer cells
   101168284 (cd82)
CD molecules [BR:ola04090]
 Proteins
  101168284 (cd82)
SSDB
Motif
Pfam: Tetraspanin
Other DBs
NCBI-GeneID: 101168284
NCBI-ProteinID: XP_004069600
UniProt: A0A3B3H418 A0A3P9KTB5
LinkDB
Position
6
AA seq 256 aa
MGKGCITVTKYFLFLFNLLFFIFGALIMGFGLWVLFDNQSFISVLHESSHTVKVASYIFI
GVGSLSMAMGFFGCIGAIYEIRCLLGLYFTCLLLILIAQVTAGVLIYFQRDRLKYEMSSI
IQGMIINYTGLNRTTEHTWDYIQKTMKCCGWTGPGNWSENLLIKNNTQKLYSCSCRNESL
PGSDVKNVGLCENLSDELPVYETGCITSVEKWLRENCAVILGICVGVAVVELLGMILSMC
LCKSVVQEDYTKVPKY
NT seq 771 nt   +upstreamnt  +downstreamnt
atggggaagggatgcatcacagtcaccaaatactttctatttctcttcaatctccttttt
tttatctttggagcgttgatcatgggctttggactctgggttctctttgataatcagagc
ttcatttctgttctgcatgaatcgtctcacacagtgaaagtggcttcttacattttcatt
ggtgtgggctccctgtccatggccatgggcttctttggctgcattggtgccatctatgag
atccgctgtctcctgggtttgtacttcacctgcctcctgctcatcctcatcgctcaggtc
acagctggagttcttatttacttccagagagatcggctgaaatatgagatgtccagcatc
atccagggcatgatcatcaactacaccgggctgaacaggaccacagagcacacatgggac
tacattcagaaaactatgaaatgttgtggatggactggtccagggaactggtctgagaac
cttctgatcaagaacaacacccagaagctttactcgtgctcctgccgcaacgagtccctc
cctggctctgatgtgaagaacgtgggcctgtgtgagaacctgtctgatgagctgcccgtc
tatgaaacgggttgcatcacttcagtggagaagtggctgcgggaaaactgcgcagtgatt
ctgggcatctgtgtcggtgtggcagttgtggagctgctggggatgatcctctccatgtgc
ctgtgcaagagtgtggtccaggaggattatactaaagtaccaaagtactga

DBGET integrated database retrieval system