KEGG   Oryzias latipes (Japanese medaka): 101156348
Entry
101156348         CDS       T02443                                 

Definition
(RefSeq) protein phosphatase 1D isoform X1
  KO
K10147  protein phosphatase 1D [EC:3.1.3.16]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    101156348
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ola01009]
    101156348
Enzymes [BR:ola01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     101156348
Protein phosphatases and associated proteins [BR:ola01009]
 Protein serine/threonine phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    101156348
SSDB
Motif
Pfam: PP2C PP2C_2
Other DBs
NCBI-GeneID: 101156348
NCBI-ProteinID: XP_023818363
LinkDB
Position
14
AA seq 566 aa
MEDSLLFRMSAFSEQGGRKYMEDVVEIRIEYEPTASSVEDYPKSQRDGGTGKMEDEAAKQ
PVEARGGPAESGPATVAWVQSLSNEDSCSISSPVSNQQQCAEQTVDTRRSVAFFAVFDGH
GGREAAHFASEHLWGLLKRQRGFWSKDPSEVCAALRKGFIACHHAMWKELPTWPKTITGL
PSTSGTTASVVVIRGVHMYIAHVGDSAVVVGVKENDSDITLQALEVTQDHKPELPKEKER
IERLGGSVMKKSGVNRVVWKRPRLTHNGPVRRSTVIDQIPFLAVARSLGDLWSYDFYSGE
FVVSPEPDTTVMTLDPKRHRYIILGSDGLWNMMPPTNAVNMCYNHDKMVGPKGMSCARRL
GCTALLFWKDRMLRADNTTVIVLALQEREAAPIPMHRDEILVDMASGIDRIPFPGTTYNT
CEVQKISDPVTAPSTYNDSSGTLLQAFGLYEAAFSATTQLLPQADSVSASLPHLEVSPNV
FEKQDETTLVDCALVAPPFKRPRRSSLRTSEPKSPHQKPIKSSNKGFSATTLPEQVPRSA
DRSAVTSSPEEGDILAQHQSSTLCVC
NT seq 1701 nt   +upstreamnt  +downstreamnt
atggaagactcgttgctgtttcgtatgagtgcattttccgaacaaggagggagaaaatac
atggaggatgttgtcgaaataagaatcgagtacgagcccacggcgtcatcagtggaagat
tatccaaagtcgcagagggatggaggaacggggaagatggaggatgaagccgcaaagcag
cccgtggaagcgcgtggtggtcccgccgaatcgggacccgcgaccgtggcgtgggtgcag
agtctatccaacgaggacagctgcagcatcagctccccggtgtccaaccagcagcaatgc
gcggagcagactgttgacacgcgcaggtccgtggcctttttcgccgttttcgacggtcac
gggggtcgcgaggcggcacatttcgccagcgagcatctgtggggtttgctgaagagacag
cggggcttctggtcgaaggatcccagcgaggtgtgcgcagccctccggaaaggattcatc
gcctgtcaccacgcgatgtggaaagagctaccgacatggccaaagactattactggcctg
cccagtacgtctgggaccacggcgagcgttgttgtgattcgtggagttcacatgtacatc
gctcatgtgggagattcggcagtcgtggttggcgtgaaagagaatgactctgatattacc
ctgcaagcccttgaagtaacacaagatcataaaccggagctccctaaagaaaaagagagg
atagaacggctgggtggcagtgtgatgaagaagtctggggtgaatcgtgtcgtctggaag
aggccccgactgacccataacggcccggtgaggaggagcacggtcatagaccagattcct
ttcctggctgttgcccgatctctaggggatttatggagctatgacttctacagcggggag
tttgtcgtttctccagaaccggacaccactgtgatgacccttgatcccaaacgccatcgc
tacatcattcttggcagtgatggcttatggaatatgatgccacccacaaatgctgtcaac
atgtgctacaatcacgacaaaatggtgggacccaaggggatgtcttgcgcacggaggctg
ggctgcacggctctgctgttctggaaggaccgcatgctccgcgcagataacaccaccgtc
atcgttctggccttgcaggagcgtgaagctgcacccataccgatgcaccgagatgagatt
ctcgtggacatggcttctggaattgatcgaattcctttccccggaacaacttacaacacg
tgcgaagtccagaagataagcgatcctgtgactgctccatccacatataacgatagctca
ggaactctgctgcaggcgttcggcttatacgaggccgctttcagtgccaccactcagctc
ttaccccaagcagactctgtgagcgcctcactgccccacctggaggtttcacccaacgtt
ttcgaaaagcaagacgaaacaaccttggtagactgcgccctcgttgctccacctttcaag
aggccccgtcgctcctccttgagaacctcagaacccaaatctcctcatcagaaacccatc
aagtcctctaataaggggttttctgcaacaactctgcccgaacaggtgcctcgctctgct
gatcgaagcgcagtaacgagctcacccgaagaaggcgacatcctagcgcagcaccaaagc
tccactctgtgcgtgtgctga

KEGG   Oryzias latipes (Japanese medaka): 101165192
Entry
101165192         CDS       T02443                                 

Gene name
ppm1d
Definition
(RefSeq) protein phosphatase 1D
  KO
K10147  protein phosphatase 1D [EC:3.1.3.16]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    101165192 (ppm1d)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ola01009]
    101165192 (ppm1d)
Enzymes [BR:ola01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     101165192 (ppm1d)
Protein phosphatases and associated proteins [BR:ola01009]
 Protein serine/threonine phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    101165192 (ppm1d)
SSDB
Motif
Pfam: PP2C PP2C_2 Apelin
Other DBs
NCBI-GeneID: 101165192
NCBI-ProteinID: XP_023817475
LinkDB
Position
13
AA seq 544 aa
MEHALLMRVSVFTDQGGRKYMEDVTEVIVEPEPGENDDPRPEEEREESGGDEDPLSPLAG
DSDPASKPEEPLQVPDAPGKEIQREGSCTFVARNLSPRQQPSPVNATKPVAFFAVFDGHG
GREAAQFARDYLWEFIKKQRGFWSDCDREVCSAIRKGFVACHHAMWKKLPEWPKTMTGLP
STSGTTASVVVLRGNRMYVAHVGDSSVVLGVQDDPSVPFIRAAEVTQDHKPELPKEKERI
EGLGGSVIKKSGVNRVVWKRPRLSHNGPVRRSTVIDQIPFLAVARALGDLWSYDFYSGEF
VVSPEPDTSVVVLDPRKHRYIILGSDGLWNMVPPQEAISMCQSNDEDMEPCGISSARQLV
SHALLRWRQRMLRADNTSAIVIALQDSGGSQKILHHEEVLLDLSRASQYPSISASRADTP
VLLGPPEEDSSSPVCDFLPALERRDGLLGSNRLYCMNFSDPFALTSLGSNSGTEFPGLSC
SAERTVSTKRFNESPTSGLLAKKARRRTSDRLPLAQHNVEKKQKESSNVSPILQQHNKTT
VCVY
NT seq 1635 nt   +upstreamnt  +downstreamnt
atggaacacgcactgctgatgcgagtgagtgtgtttactgatcagggaggcaggaaatat
atggaagatgtgaccgaggtcatagtagagcccgagccgggcgaaaacgatgatccgagg
ccagaggaggagcgggaggaaagcggcggggatgaggatcctctcagccctctggccgga
gactccgaccctgcttccaaaccagaagaacccctgcaggtccctgatgcccccggtaaa
gagatacagagagaaggaagctgtactttcgtggcgaggaatctgtcacctcgacaacag
ccaagtcccgtaaatgccacgaagcccgtggcattttttgctgtttttgacggccacggg
ggtcgagaggccgcgcagttcgcacgggattatctgtgggagttcatcaagaagcagcgg
gggttctggtccgactgtgaccgggaggtgtgctcagcgatacgcaaaggattcgtagcc
tgccatcacgctatgtggaaaaagctacctgaatggccaaaaactatgacaggccttcca
agcacatcgggcaccaccgccagtgtagtagtactacgaggaaaccgtatgtatgtggcc
cacgttggggattcttctgtagttctgggggtccaggatgacccgtctgtgccattcatc
agagctgctgaagtcacccaagaccacaaaccggaattgccaaaagaaaaggagcgtatt
gaaggtctgggaggaagcgtgataaagaagtctggagtgaaccgggtggtgtggaagagg
cccaggctcagtcacaatggtccagttcgccgcagcaccgtgatagaccagatacctttc
ctggctgtagcccgggctttaggtgatttatggagttatgacttctacagcggggagttt
gttgtctctccagagccagacactagtgtagtggtccttgaccctaggaagcatcgctac
atcatcctgggcagtgatggtctgtggaatatggtgccaccccaggaggccatctccatg
tgccagagcaacgatgaggacatggaaccctgtggcatctcaagtgcaaggcaactggtc
agccacgctctgctgcgatggcgccagcgaatgctccgtgccgataacaccagcgctatc
gtgattgctctgcaggattcaggaggttctcaaaaaatcctgcatcatgaagaagttctg
ctcgacctgtctcgggcgtcccagtatccgtccatctctgcgtctcgtgctgacacgccg
gtcctcctgggtcctccagaggaagattcctcctcccccgtgtgtgacttcctacctgct
ctggaacgacgagatggattgctgggaagcaacagactgtattgcatgaacttctcagac
ccctttgcgctgacttctttgggttccaacagcggcacagagttcccgggtctgtcttgt
tcagctgaaaggacagtaagcactaaaaggtttaatgagtcccccacttcaggcctgctc
gccaaaaaagctcgccgcaggacttctgaccgactgccgttggcccagcacaatgtagag
aagaagcagaaggaatccagcaacgtctctcccattcttcagcagcacaacaagaccaca
gtgtgcgtgtactga

DBGET integrated database retrieval system