KEGG   Oryzias latipes (Japanese medaka): 101156492
Entry
101156492         CDS       T02443                                 

Definition
(RefSeq) uncharacterized protein LOC101156492
  KO
K04726  BH3 interacting domain death agonist
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
ola04210  Apoptosis
ola04217  Necroptosis
ola05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ola00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101156492
   04217 Necroptosis
    101156492
   04115 p53 signaling pathway
    101156492
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101156492
SSDB
Motif
Pfam: BID Terpene_syn_C_2
Other DBs
NCBI-GeneID: 101156492
NCBI-ProteinID: XP_004069898
LinkDB
Position
6
AA seq 193 aa
MDVTKYPENGEHICFLIFAFLQADCRDSYLQQELFSLGKDFNIIRDKNSDSRTAYVDNEG
IESDGHLDESISLPLDDILPLVELQGDHAVAAALWDVAQGLRTIADQFEDRVVNQATRDL
RSRIEKSLPEQWAQLLKHEVTRMMNQGLGMENFAQERVIMACTFTLVKGVCKQAPHLLRN
LFEAALQFVWCGA
NT seq 582 nt   +upstreamnt  +downstreamnt
atggatgtcaccaagtatccagagaatggagaacatatctgcttcttaatttttgccttc
cttcaagcagactgtagagactcgtatctgcagcaggagctttttagtctgggaaaggat
tttaacatcatcagggacaagaactctgactcaagaacagcttatgtggacaatgaaggc
attgaatctgatggacacctagatgagagcatttcgcttcctctggatgacattctgccc
ctagtggaactgcagggagaccatgcagtagcagcggccctctgggacgtcgcacaaggt
ctgaggacaattgcagaccagtttgaggacagagtcgtcaatcaggcgacccgggacttg
agaagccgcatagaaaaatctctccctgagcagtgggcacagctgctcaaacatgaagtc
acccggatgatgaaccagggactaggtatggagaactttgcccaggagcgggtgatcatg
gcctgcaccttcaccctggtgaagggggtgtgcaagcaggccccccacctgctgaggaac
ctctttgaggctgcgctgcagttcgtctggtgtggagcatga

DBGET integrated database retrieval system