KEGG   Oryzias latipes (Japanese medaka): 101156596Help
Entry
101156596         CDS       T02443                                 

Definition
(RefSeq) high mobility group protein B1
  KO
K10802  high mobility group protein B1
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola03410  Base excision repair
ola04140  Autophagy - animal
ola04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:ola00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    101156596
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101156596
  09143 Cell growth and death
   04217 Necroptosis
    101156596
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ola03036]
    101156596
   03400 DNA repair and recombination proteins [BR:ola03400]
    101156596
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ola04147]
    101156596
Chromosome and associated proteins [BR:ola03036]
 Eukaryotic Type
  Nucleosome assembly factors
   HMG (high mobility group) proteins
    101156596
DNA repair and recombination proteins [BR:ola03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     101156596
   MMR (mismatch excision repair)
    Other MMR factors
     101156596
Exosome [BR:ola04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   101156596
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMG_box_2 HMG_box HMG_box_5
Motif
Other DBs
NCBI-GeneID: 101156596
NCBI-ProteinID: XP_004075350
UniProt: H2LG42
LinkDB All DBs
Position
13
AA seq 194 aa AA seqDB search
MVKDPKKPRGKMSSYAYFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSPKEKGKFE
DMAKQDKVRYEREMKNYVPPKGQKKKRFKDPNAPKRPPSAFFLFCADFRPKIKSESPGLS
IGDTAKKLGEMWNSSSAEEKQPYEKKAAKLKEKYDKDIVAYRTKGKVDSESASAADEEEE
GEEEEEEEEEDEDD
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggatccaaaaaagccaaggggcaaaatgtcctcatatgcttactttgtgcaa
acatgccgagaggagcacaagaagaaacaccctgatgcttcagtcaatttttcggaattc
tccaagaaatgctctgagcgatggaagacaatgtcacctaaagagaaaggcaagtttgaa
gatatggccaaacaagacaaggtgcgttatgagagagaaatgaagaattatgtacccccc
aaggggcagaagaagaaacgattcaaggacccaaatgctccaaagagaccgccgtctgct
ttctttcttttctgtgcagattttcgccccaaaataaaaagtgaaagccccggactttcc
attggcgacaccgccaagaaactcggggagatgtggaacagctcgtctgcggaggagaag
cagccgtacgagaagaaggcggccaaattgaaggagaaatatgacaaagacatcgttgct
taccgtacaaaaggcaaagtcgattcagaatcagcttctgccgctgatgaagaggaagaa
ggagaggaggaggaggaggaagaggaagaagatgaggatgattag

KEGG   Oryzias latipes (Japanese medaka): 101165167Help
Entry
101165167         CDS       T02443                                 

Definition
(RefSeq) high mobility group-T protein
  KO
K10802  high mobility group protein B1
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola03410  Base excision repair
ola04140  Autophagy - animal
ola04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:ola00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    101165167
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101165167
  09143 Cell growth and death
   04217 Necroptosis
    101165167
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ola03036]
    101165167
   03400 DNA repair and recombination proteins [BR:ola03400]
    101165167
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ola04147]
    101165167
Chromosome and associated proteins [BR:ola03036]
 Eukaryotic Type
  Nucleosome assembly factors
   HMG (high mobility group) proteins
    101165167
DNA repair and recombination proteins [BR:ola03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     101165167
   MMR (mismatch excision repair)
    Other MMR factors
     101165167
Exosome [BR:ola04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   101165167
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMG_box_2 HMG_box HMG_box_5
Motif
Other DBs
NCBI-GeneID: 101165167
NCBI-ProteinID: XP_004076239
UniProt: H2LE57
LinkDB All DBs
Position
14
AA seq 206 aa AA seqDB search
MGKDPTKPRGKMSSYAYFVQTCREEHKKKHPDASVNFAEFSKKCSERWKTMSAKEKGKFE
DMARQDKVRYDREMMSYVPAKGAKTKKFKDPNAPKRPPSAFFIFCSEFRPKVKGESPGLT
IGDVAKRLGEMWNSTSAEDKQPYEKKAAKLKEKYGKDIAAYRAKGKTGGGAPAKAPAKVE
KKMDDDDDDDDDDEEEEEDDDDEDDE
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggggaaagatccgactaagccgagggggaagatgtcctcctatgcctactttgtccag
acttgcagggaggagcacaagaagaagcaccccgatgcctcggtgaactttgccgagttc
tccaagaagtgctctgagcgatggaagacaatgtccgccaaggagaagggcaaatttgag
gacatggccagacaggacaaggtgcgatatgatcgggagatgatgagctatgttccagct
aaaggagccaagacgaagaagttcaaggaccccaacgcccccaagagacccccatccgct
ttcttcatcttttgctcggagttccgcccgaaggtgaaaggcgagagccccggcctgaca
attggtgacgttgccaagagactgggcgagatgtggaacagcacctcggcggaggacaaa
caaccctacgagaagaaagcggccaagctgaaggagaagtacggaaaggacattgctgct
taccgcgctaagggtaaaacaggtggtggggctccggcaaaagcccccgccaaggttgag
aagaagatggacgacgacgatgatgacgacgacgacgacgaggaggaagaggaggatgat
gatgatgaggatgacgagtag

DBGET integrated database retrieval system