KEGG   Oryzias latipes (Japanese medaka): 101157021Help
Entry
101157021         CDS       T02443                                 

Definition
(RefSeq) neutral alpha-glucosidase C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00052  Galactose metabolism
ola00500  Starch and sucrose metabolism
ola01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101157021
   00500 Starch and sucrose metabolism
    101157021
Enzymes [BR:ola01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     101157021
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110 NtCtMGAM_N
Motif
Other DBs
NCBI-GeneID: 101157021
NCBI-ProteinID: XP_011489077
LinkDB All DBs
Position
22
AA seq 892 aa AA seqDB search
MTAKTESVSSVVPNDEGKVKFKKSADVAFYRRQIQGPKFSHQALLDTLVLTEGGAQFELL
QAVSQTRLLLSLSAHKSDFVRILIDEVLPIKPRYRVPDVIVEKQRSEQLRVERQTEDSVT
LSWSSGCHQVRVWRFPFRLEVLCEQEEMVTFNCEDKLWFESLQRPPSELQEEQTSSWRES
FREFVDVKANGPSSVGADLRLHGFNHVYGLPEHADELQLRETRGGEPYRLYNLDVFAYDL
HSRLGLYGSVPLVLAHKADRTLGVFWLNASETFVHLEYSSTDIQEAPLMKRRRTPPHTDV
HWLSESGVIDCMVLLGPGPHQFFKQYADLTGYQALPPLFALGYHQSRWNYRDEADVKAVD
AGFDVHRIPYDVMWLDIEHTDGKRYFTWDSALFPDPVGLQRHLQARGRKMVVISDPHIKT
DPCWALYRDAREGEHFIKDREGQVYCGSCWPGESSYLDFSSSRTRAWYSRCFSLEKYKGS
TPSLFVWNDMNEPSVFGGPEQTMPKDAVHHGGWEHRDLHNLYGFYQHKATVEGLITRSGG
SERPFVLSRSFFAGSQRFGAVWTGDNVATWEYLRISIPMVLSLSLAGVAFCGADVGGFVQ
DPEPELLVRWYQAAALQPFFRGHAAMETKRREPWLFGEEVTAVIRSAIQQRYRLLPFWYT
LFHRAHTCGLPPVRPLWIEFPTEESTFTVDDRYMIGGALLACPVTEPGIQEVQVSLPGPE
EVWYDIHSKKVYGGGGTLRLPVTLDSVPVFQRGGSVICRSVGSGTCTADFQLLPLDITVA
INSQGGAEGELYLDDGHSFCFRDRKAFSLRGFSMQAGRLLCRAASREGSFHCGTVVQSVT
VLGMKKPPSSVTLYVPGEEDRSASFEFVEACGVLTVHNLELRVTADWEIHIC
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaaagaccgagtctgtcagcagcgttgttcccaacgatgaaggaaaagtgaag
ttcaagaaaagtgccgatgttgcattctacaggcgacagattcagggccccaaattttcc
catcaagcccttctggatacgctggtgctcacagaggggggggctcagtttgaactactg
caagctgtttcacagaccaggctgctgctgtctctgtcagctcacaagtcggactttgtg
aggattctcatcgatgaagtcctgcccattaagcctcggtaccgagtcccggatgtgatc
gtggagaagcagcggagtgaacagctgagggtggagaggcagacagaagactcagtcacc
ctttcttggtcttcggggtgtcaccaggtgcgagtttggcgtttccctttccgcctggag
gtcctgtgtgagcaggaggagatggtcactttcaactgtgaagacaaactgtggtttgaa
agtctccagcgtcctcccagcgagctccaggaagaacagaccagctcatggagggagagc
ttcagggagtttgtggatgtcaaagccaacggtcccagcagtgtcggcgcagacctccgt
ctccatgggtttaaccacgtctatggtctccccgaacacgcagacgagctgcagctcaga
gaaacccgaggtggagaaccgtaccggctctataacctggatgtgttcgcctacgacttg
cacagccggcttggcctgtacggctctgtcccgctggtactagcccataaagcagacagg
actcttggtgtgttttggctgaacgcatcagagacttttgtccacttggagtattcttcc
actgacattcaggaagcccccctgatgaagaggagacggactcccccacacacggacgtc
cactggctgtcagagagtggcgtgatcgactgcatggttcttctcgggcctggcccacac
cagttctttaagcagtatgctgatctgacagggtaccaggcgctgcccccactgtttgcc
ctggggtaccaccagagccgctggaattaccgggacgaggcagacgtgaaggccgtggat
gcgggtttcgacgtccaccggatcccctacgacgtcatgtggctggacatcgaacatact
gacgggaagagatacttcacatgggactctgccctgtttcctgacccagtgggcctgcag
cgccacctgcaggcgagggggaggaagatggtggtgattagcgacccccacatcaagacc
gacccctgctgggctctgtaccgggatgctcgagagggagagcatttcatcaaggacagg
gagggccaagtctactgtggctcctgctggcctggtgagtcatcttacctggatttcagc
agttcacgaacccgagcttggtattctagatgcttcagcctggagaagtacaagggatcc
actccatctctgtttgtgtggaacgacatgaacgagccgtcggtgtttggtgggccggag
cagaccatgcccaaggatgcggtacatcacggcggctgggagcaccgggacttgcacaat
ctctatggcttttaccagcacaaggccacagtggagggtctcatcactcgctcagggggc
tcagagcgaccctttgtcctctcgcgctctttctttgccggctcgcaaagatttggagca
gtctggacaggggacaatgtagccacctgggagtacctgaggatctctattcccatggtt
ttgtccctgagcctggccggtgtggccttttgtggagcggatgtgggggggtttgttcag
gatcctgagccggaattgttggtgcgctggtaccaggcagcggccctgcagccatttttc
cgcggacatgctgccatggagacgaagcgcagggaaccctggctctttggggaagaagtc
actgcagtcatccgctctgcaatccagcagaggtaccgtctgctgccgttctggtacact
ctgttccaccgcgctcatacctgtggtctgccgccggtcagacctctgtggatagagttc
ccaacggaggagagcaccttcaccgtagatgaccgctacatgattggcggagctttgctt
gcctgtccagtgacagaaccaggcattcaggaggtccaagtctcccttcctggacctgaa
gaggtctggtatgacatccactccaaaaaggtgtacggaggaggcgggactctgcgtctg
ccagtcactctggactctgtcccggtgttccagcgcgggggctctgtgatctgtaggtcg
gtgggctctgggacctgtactgccgacttccagcttctgcctctggacatcactgtagcc
ataaactctcagggcggggcggagggggagctgtacctggacgacggccactccttctgt
ttccgggacaggaaggccttcagcctgcgtgggttcagcatgcaggcaggacgtttgctg
tgcagggctgccagtagagagggatccttccactgtgggacggtggtgcagtctgtcacc
gttctggggatgaagaagccgccatcttctgtgactctatatgtaccaggtgaggaggac
agatcggcttcctttgaatttgtggaggcttgtggcgtgctgacagtccacaacctggag
ctccgcgtcaccgcagactgggagatccacatatgttaa

DBGET integrated database retrieval system