KEGG   Oryzias latipes (Japanese medaka): 101157099
Entry
101157099         CDS       T02443                                 

Gene name
atr
Definition
(RefSeq) serine/threonine-protein kinase ATR isoform X1
  KO
K06640  serine/threonine-protein kinase ATR [EC:2.7.11.1]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola03460  Fanconi anemia pathway
ola04110  Cell cycle
ola04115  p53 signaling pathway
ola04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:ola00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    101157099 (atr)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101157099 (atr)
   04115 p53 signaling pathway
    101157099 (atr)
   04218 Cellular senescence
    101157099 (atr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ola01001]
    101157099 (atr)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ola03400]
    101157099 (atr)
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101157099 (atr)
Protein kinases [BR:ola01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   101157099 (atr)
DNA repair and recombination proteins [BR:ola03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    101157099 (atr)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT UME FATC DUF4838
Other DBs
NCBI-GeneID: 101157099
NCBI-ProteinID: XP_011488482
LinkDB
Position
22
AA seq 2583 aa
MDGLEMSAMIPALQELASAGAAEYDQTVQKPRRILCQFIDRILTDVDVVALGLSKKSSSE
PACVMLLDFVQHLVKSSSLMFANPACHPAEYPDATQSSVDFSRWVAARFLRVAAAPSCDV
IHGRVSAVLCSLLHTLRVRVPFIFSRLTQELLFLARDLSGVLYSHISFLAERGPGQGIQM
QSRWPVLLEPFRFPPTCSSSYLSCSSLVLSSPAALESLTAATLHIITDVLRGVMSRQDLA
LAWETACFILANGNIRLKRLSMVMLRELVEWKGFPEMMSHEFFIAFFHLLETHSYTEKEE
RPYEGELLKLISCVFQPPQAPPSHFEPMHLTQLFECVCALGGGHVRLGAEVAESLCLLFS
FSLSSAPVCESTALLRKQRVAEVCRTLALTVGTNNQAECAQGFLQAALKAETANVIREEE
DGEVAAKRSCKSSTNNTSLNDVDMSARSEVWAVLKIRLEELLDPLSSAEPGSPQTLFALQ
GLALILHVAGCCFSPISPCPLLWVSAETLSRVLKSCRVVLEGAVGEQDRFQAAVRATVGI
LDFVLYLTLGRKGEDELQRDVCALLSLPWVCENKSAFAFKSSRFPSWLPALAQKLNSSLS
PEIEADCVSLLAFLHGGVCETWRLCVFTKALQNRDESVRAAAVRVFPVLLHHLGNGFHSL
IGTTLLSVQEDESEQVKVELARIVGDLSCVQSGLSTLIHKEHSSPPKFLCFHCRLKTEHD
GKVEPSLSVSVIKQFLSLLGSQATSGVKQAFLEALPHLCQHVNLTRESSDSQAVLRSLTD
LMEDPEPSVRERFSHVVQFLIQYSASDSEGSTLNELLVARLKESFSNAKKNRDDGLRSTL
ILTLGEIGRASRGSLVSFSLLRLLHCLLSKSSSVTVDAYTQIRALAAAKGLKLQTLFSQY
KNPICQFLVESLHSRHASALRSTPDQGSESANQRELALDILAQTAHAFDFPDLHRFLTRT
LQVLLPYLAAKASPTGSALIRTLAIELKANRREILINNFKYIFSHLVCSCTKEELERAFH
YLQSETEIELGSLLRQDYQGLHNELLLRLGEHYQQVFNGLAILASFASNDDPYQGPRDIT
TPEHMADYLQPKLLGILAFFNMQLLSSSAGEKDRKKLALTSVMALMRLMGSKHISSVRVK
MMTTLRTGLRYKEDFPLLCCQTWDCFVRSVEPSHLGPLLSHVIVALLPLIPPQPKETGAI
IRFLILDNREEVQDYLHEIYFLPDHPELKDIHTALQDYKKLTASSSDLAAALQLSMRAVQ
HENVDVRVHALTSLRDMMHSNQEWLLRQVCASEAVEPVISSLVSVLLKGCQDASQEARLL
CGECLGELGAVDPGRLDLSHTHTHGDRNTFVTGVDDPNFAYDLLIELTRTFLAYADDVRA
QDSAAYAIQELLSIFECREGRSDTPGRRLWRRFPEQIQEILEPHLNSRYKSSQKEVNWSK
LKKPIYLSNKGSKFSDWSATWAGYLISKVRHELASRVFKCCSFIIKHDFKVTIYLLPHIL
RYMLLGCTPAEQQEVTEEMLAVLTEGDAQEGGGAQETASSTQTVFSMVSHLTQWSRHILY
SKPKESGDFQSVVAFLKGIPQDILAKASLRSKAYTRALMHFETYILENKLNIQDHLSFLQ
TLYAAMHEPDGVRGVNALRREEPSLREQILEHESIGLLRDATACYDRAIQLESDQIDHYH
GVMTSMLGLGQLSTVITQVNGVLANKKHWKSDLNSYRVEAAWKLGKWDLLEDYLSSDQQS
STWGVGLGQLLLSMQKQDAETFCEKLKLVRTKQVVPLSAASYECGTYQRGYEYIVRLHML
SELEHAFTELQTGGSTPSLSQLPPHWSDRLEMTQKSFRAKEPILALRRALLSLGPQPVRQ
ELVGECWLQSARVARKAGHHQTAFNALLNANNTHLAELVTEKAKWLWSKGDVHQALIVLQ
KGVAQCFPDNQPLMDPRSLQTKGKAMLLVGRFMEETANFESNAIMKAYKDVTNLLPEWED
GNFYLAKYYDKVMPMVTDNKLEKQGNLIRYIVTFFGKALQFGNQYIYQAMPRMLSLWLDF
GAKVCECEKTGRADRQMRQELSKINSIVSEHCANLAPYQFLTAFSQLISRVCHSSDEVFA
ALMNIVAKVFLAYPQQAMWLMAAVSKSSYHMRMNRCNQILKKAISLKPSLDKFIGDANRL
TDKLLELCNKPVDGNSTTLSISVHFKQLKRLVEEPTFSQILIPLQSVLIPTLPSTGGTNA
KHDAFPGHWAYLDGFEDVVEILASLQKPKKISLRGSDGRSYTMMCKPKDDLRKDCRLMEF
NCLINKCLRKHAESRRRELHIRTYAVIPLNEECGIIEWVNNTAGLRHILTKLYKERGVYL
SGKELRKLILPKTAPFEEKLRIHKEVLCARHPPVFHEWFLRTFPDPTSWYSSRSAYCRST
AVMSMVGYVLGLGDRHGENILFDSFTGECVHVDFNCLFNKGETFDVPEVVPFRLTQNMVH
AMGPMGTEGLFRQACEVTLRLMRDQREPLMSVLKTFLHDPLVEWSKQTKGLSKTQVHETG
EIVNEKAKTHVCDIEQRLLGVIKSRNKVLGLPLSIEGHVHYLIQEATDEKLLCQMYLGWG
PYL
NT seq 7752 nt   +upstreamnt  +downstreamnt
atggacggacttgagatgtccgcgatgataccggctcttcaggagctagcaagtgctggc
gctgctgagtacgaccagacggtgcagaaacctcgacgcatcctgtgtcagttcatagac
aggatcctgaccgatgtggatgtcgttgctttaggtctaagtaagaagtccagctcggag
ccggcgtgcgtcatgctgctggactttgtgcagcatttagtcaaatcctcttctttgatg
tttgcaaaccctgcttgccaccctgctgaatacccagacgccacgcaaagctctgtggac
tttagtcggtgggtcgctgctcgcttccttcgggtggcggcagctccgagctgtgatgtg
atccacggacgcgtctctgcggtgttgtgctctttacttcacactctgagggtcagggtg
cctttcattttcagccgcctcactcaggagctcctttttttggcccgggacctcagcggc
gtcctgtattctcacatcagtttcctggctgagcgaggacccggtcaggggatccagatg
cagagccgatggcccgtactgctggagcccttccgcttcccgcccacgtgctcctcctcc
tatctcagctgttcctccctcgtactctcctcgcctgctgccttagagtccctgactgct
gcaaccctccacatcataactgacgttctgaggggggtcatgtctcggcaggacctcgcg
ttggcctgggagacggcctgtttcattttggccaatggcaacatcaggctaaagaggctc
tccatggtgatgttgagggaactggttgagtggaaggggtttcccgaaatgatgagccac
gaattctttattgcctttttccatttgctggaaacgcactcctacacggagaaggaggaa
cggccgtatgaaggagaactcctgaagctgatcagctgcgtgttccagcctcctcaagct
cctccctcccactttgagcccatgcatctcacgcagctgtttgagtgcgtctgtgctctt
ggaggaggtcatgtcaggttaggagcagaggttgctgaatctctctgcctgctcttcagc
ttctctctgtcttctgctcctgtttgcgagagcacggcactgctgaggaagcagcgggtc
gcggaggtctgccgcacgctggcgctgaccgtcgggaccaacaatcaggcggagtgtgct
cagggctttctccaagctgccctcaaagctgagactgctaatgtgatccgggaagaagaa
gacggagaagttgctgcgaaaagatcctgcaagtcatcaaccaacaacacatctttgaat
gacgtggacatgagcgcccgcagcgaggtttgggccgtgctgaaaattcggctggaggag
ctgctggaccctctgagctctgcagaaccggggagtccccagactctgttcgctctgcag
ggtctggccctcatcctccatgtggcgggttgctgcttctcccccatcagtccgtgtcct
ctcctgtgggtgtccgccgaaaccctcagcagagtcctgaaaagctgccgtgtggtgttg
gaaggagccgttggagagcaggatcgtttccaggctgccgttcgtgccactgttgggatt
cttgacttcgtgttgtacctgacgttgggtagaaaaggggaggatgagctgcagcgggat
gtgtgtgctctgctgtctctgccctgggtgtgcgagaacaagtctgccttcgcctttaag
agttcgagattcccttcctggctgcctgctttggcccagaagctcaacagctctctttca
cctgaaatcgaggcagactgtgtgtcgctgctcgccttcctgcatggcggcgtgtgtgag
acgtggcgcctgtgcgtctttacaaaagcgctgcagaatcgggatgaatccgtcagagct
gcagccgtccgggttttcccggtccttcttcatcacctgggaaatgggttccacagcctc
atcgggacaactctcctgtctgtgcaggaagatgaatcggagcaggtgaaggtggagctc
gcccggatcgttggagacttgagctgcgttcagtctggactttctaccctcatacacaaa
gaacacagcagccctcccaaattcctctgcttccactgcaggctgaaaacagagcatgat
gggaaagtagagccatccctcagcgtttctgttatcaaacagtttctgtctttacttgga
tcacaagctacaagtggcgtcaagcaagccttcttggaagctctgcctcacctttgccag
catgtgaacctgaccagggaaagcagcgactcccaggcggttctccgttctctgaccgac
ctcatggaggatccagaaccttccgtcagagagcgcttcagccacgtggtgcaattcctg
atccaatactctgcaagcgactcagaaggaagcactctgaatgagctcctggtcgcgcgt
ctgaaggagtccttcagcaacgccaaaaagaaccgagacgacggtctgcgtagcactctc
atcctcactcttggagaaattggcagagcttctcggggtagtttggtgtctttttccctg
ctgcggctcctccactgtctcctgtccaagtcgtcgtccgtgacggtggatgcctacact
cagataagagcgctggctgctgctaaaggcttgaagctgcagaccctcttcagtcagtac
aagaaccctatatgtcagtttcttgtggagtcgctgcattcacggcacgcatcggcgctg
aggagcaccccagaccagggcagcgaatcggccaatcaaagagagctggctcttgacatc
ctggctcagaccgcgcacgcgttcgacttcccggaccttcaccgcttcctcacacggacg
ctccaggtgcttctgccgtacctggcagctaaggccagccccacaggctccgccctcatt
cgtactctcgcaatcgagctgaaggcgaacaggagggagattctcatcaacaactttaaa
tacatctttagccacctggtctgctcctgcaccaaggaagagttggagagggccttccac
tacctgcagagtgaaacagagatcgaactgggctctctgttacgccaagactaccagggt
cttcacaacgagctgctgctgcgtctgggagaacattaccagcaggtttttaatggattg
gcaatcctggcctcctttgcatccaatgacgatccgtatcaggggccacgagacattacc
accccagaacacatggcagactacctgcagccgaagcttctgggaattctggccttcttt
aacatgcagctgctgagctccagtgcaggagagaaagaccgcaaaaagttggctttgacg
agtgtgatggctctgatgcgcctgatgggctccaagcacatcagctccgtcagggtgaag
atgatgaccacgctgcgcaccggcctccgatacaaagaagacttccctctgctgtgctgc
caaacatgggattgttttgtgaggagcgtggaaccatcacacctcgggcctcttctcagt
cacgtgatcgttgcattgctccccttgatccccccacagcctaaagaaactggagccatc
atccgtttccttatcttggacaacagggaggaagttcaagactaccttcacgagatctac
tttctgccagatcacccggagctcaaagacatccacacagctctgcaggattacaaaaag
ctgacggccagcagcagcgatctggcggcggcgctgcagctctccatgagagccgtccag
cacgagaacgtggatgtgagggtccatgctctgaccagcctgcgggacatgatgcacagc
aaccaggagtggctgctgcggcaggtgtgtgccagtgaggcggtggagccggtcatctcc
agcctggtgtcggtgctgctgaagggctgccaggacgcgtctcaggaagccaggcttctc
tgcggggagtgtctcggggagctgggggccgtggatccaggacgtctggacctgtcgcac
acacacacccacggagaccgcaacacctttgtgactggcgttgatgatcccaattttgcc
tacgatttgctgatagaactgaccaggacatttctggcttacgctgacgacgtgcgcgcc
caggactcagccgcttacgccatccaggaactcctgtctatattcgagtgtcgtgagggg
aggagtgacaccccaggacgccggctgtggaggagatttccagaacaaattcaagagatt
ctggagcctcatctcaacagcagatataagagcagccagaaagaggtgaactggtctaaa
ctgaagaagcccatttatcttagcaacaaagggagcaagttttctgattggtcggctacc
tgggccggttacctcataagcaaggtgagacacgagctggctagcagagtgttcaaatgc
tgcagcttcatcatcaagcacgacttcaaggtcaccatctacctgctgcctcacatcctg
cgctacatgctgctgggctgcacacctgcagagcagcaggaggtaacggaggagatgctc
gctgtgctgacagaaggtgatgcacaggaaggaggcggagcccaggagacggcctccagc
actcagactgtgttcagtatggtatcacacctgacgcagtggagccggcacatcctgtac
tccaaacccaaagaaagtggggatttccagagcgtggtggcattcctgaagggaattcca
caggacattctggccaaggcctccctgcgatccaaagcgtacacccgggctctcatgcac
tttgaaacttacatcctagaaaacaagctaaacatccaggaccacctaagcttcctgcag
acgttgtacgctgccatgcacgagcccgatggagtgcggggcgtcaacgcgttgaggaga
gaggagccgtcgctacgggaacagatactggagcacgagagcatcggcctgctccgagac
gcgaccgcctgctacgaccgagccatacagctggagtctgaccagattgaccattatcat
ggcgtgatgacgtctatgctcggtctgggacaactctccacagtcatcacacaagtcaac
ggagttctagccaacaagaagcattggaaatcggacttgaactcctacagagtggaggca
gcctggaagctcggaaagtgggacctgctggaagattatttaagttcagaccagcagtcg
agcacttggggagtggggcttggccagctgctgctctccatgcaaaagcaggacgctgag
actttctgtgagaagctgaagctggtgaggaccaaacaagtggtccccctgtctgctgct
agctatgagtgtgggacctaccagagaggatacgaatacatcgtccggctgcacatgctg
agtgagctggagcacgccttcactgagctgcagactgggggctccactccgagtctcagc
cagctgcccccccactggtcagaccgattggagatgactcagaagtccttcagggccaaa
gaacctatcctggctctccgtcgcgccctgctcagcctgggaccacagcctgtgcgtcag
gagctggtcggggagtgctggctccaaagtgctcgggtggccaggaaggccggacaccac
cagacggctttcaacgccctcctcaacgccaacaacactcacctggctgagctggtcaca
gagaaggccaagtggctctggtccaagggtgatgtccaccaggccttgattgtactgcag
aagggcgtggcacagtgtttccccgataatcagcccctgatggacccacgcagccttcaa
accaaaggcaaggccatgctgctggtgggacgcttcatggaggagacggcaaacttcgag
tctaatgccatcatgaaggcctataaggatgtgacaaaccttctaccagagtgggaggat
gggaacttctatctggctaagtactatgacaaagtgatgccaatggtgaccgataacaag
ctggagaagcaaggaaacctcatccgatacatcgttacgttcttcggaaaggcacttcag
tttggaaaccagtacatctaccaggccatgcctcgcatgctgtcgctctggttggatttt
ggagccaaagtgtgtgaatgtgagaaaactggacgcgcagacagacagatgcgacaggag
ctcagtaaaatcaactccatcgtgtctgagcactgcgccaacctggctccataccagttc
ctcaccgccttctcccagctcatctctagagtgtgtcattccagtgatgaggtctttgct
gctttaatgaatatcgtagccaaagtcttcctggcatacccgcagcaggccatgtggctg
atggctgctgtttccaagtcttcgtaccacatgcgtatgaaccgctgtaatcagatcctt
aaaaaagccatcagtctaaaaccgtctctggacaagtttattggagatgccaacagactg
acggacaagctgctggagctctgcaacaaaccggtggacggaaacagcaccaccctcagc
atcagcgttcacttcaagcagctgaaacgtctggtggaggagccgaccttcagccaaatc
ctgatcccactgcagtccgttctcatcccgacgctgccttcaaccggcgggacaaacgca
aagcacgacgctttcccaggccactgggcgtacctggatggctttgaagatgttgtggag
attttagcttctttacagaagcctaagaagataagtctgaggggctccgatggccgaagt
tacaccatgatgtgtaaaccgaaagatgatctgaggaaggactgcaggctcatggagttc
aactgcctcatcaacaagtgtctgcgcaaacacgcagagtcgaggcggagggaacttcac
atccgcacctacgctgtgattcccctcaatgaggagtgcggcatcatcgagtgggtcaac
aacaccgctggactgcgacacatcctcaccaagctgtacaaggagaggggtgtctattta
tcgggcaaagagctgaggaagcttattctaccaaagacggctccctttgaggagaaactg
aggatccacaaggaggtgctgtgcgcccgccatccgccggtcttccatgagtggttcctg
cggaccttcccggacccaacctcgtggtacagcagtcgctctgcgtactgccgctccact
gctgtgatgtcaatggtcggctacgtcctgggcctcggtgatcgccacggagaaaacatt
ctttttgactcatttactggagagtgtgttcatgttgacttcaactgcctcttcaataag
ggggagacctttgatgtgcctgaggtggttccattccggctgacccaaaacatggtccac
gctatggggcccatgggtaccgagggcctctttcgacaagcctgtgaggtcacattaaga
ttaatgagagaccagcgagagccgctgatgagtgtgctgaagaccttccttcatgacccc
ttggtggagtggagcaaacaaaccaaaggactgtcaaagacccaagtccacgagactggc
gagatagtaaatgaaaaggcgaaaacacatgtgtgtgacatcgagcagcgcctgctgggg
gtgataaagagcaggaacaaagtgctgggactacctctgtccatagaaggacacgtgcat
tacctcatccaagaggccacggatgaaaaacttctctgccagatgtatttgggttggggt
ccatacctgtaa

DBGET integrated database retrieval system