KEGG   Oryzias latipes (Japanese medaka): 101157458Help
Entry
101157458         CDS       T02443                                 

Definition
(RefSeq) low-density lipoprotein receptor-related protein 2 isoform X1
  KO
K12473  low-density lipoprotein receptor
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ola00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101157458
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ola04131]
    101157458
Membrane trafficking [BR:ola04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    101157458
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 101157458
NCBI-ProteinID: XP_023813787
LinkDB All DBs
Position
8
AA seq 430 aa AA seqDB search
MAASTVEMAPMNFQAPAWQEHVNLQSSIVETAFTCVYRAPGAVMVKLTVRTELMRGAVVG
LHFILMHICARLPLSDLSNTKQCLASDLRCENGQCVSASFVCDEDEDCDDGSDEASCPPI
TCSSASFQCNNSICIPRQWACDGYNNCPDGSDEWPQSCHAESPVTLASHQCHSMEFHCGS
GECIHGSWKWDGDADCLDGSDETGCTRSTCCPDEFECGDGTCIHGSRQCNQQYDCRDTTD
ESGCVNVTRCEGPDKFKCRSGECITMERVCDSKRDCRDWSDEPLRECEAPTPAGPSQSES
PSASTTRLPLRTSPRATLNPRLHHSSAGGDHQYHPQGCNPHHPKVTDTEDHQAFNQEHHT
TPKDHYSQADRSESPADLHRGSNHLSGKQTWAWCDSLLGPPSGGSLSVGCWWRAAVEELQ
VEKLQHHPLS
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtcgactgtggaaatggcaccgatgaacttccaagcacctgcttggcaagaa
catgtaaacctacagagttcaattgtggagaccgctttcacctgtgtttaccgagctcct
ggcgctgtgatggtaaagctgactgtgagaacagagctaatgagaggggctgtggtaggc
ttgcacttcatcttaatgcacatctgcgctcgtctgcctctctctgacctctcaaacact
aaacagtgtttagcctcagacttgcgctgcgagaatggccagtgcgtctcagcttccttt
gtgtgtgacgaagatgaggattgcgatgatgggagtgatgaggcctcctgccctcccatc
acctgcagctctgcatccttccagtgcaacaacagcatctgcatccctcgccagtgggcc
tgtgacggttacaacaactgccctgatggctcagacgagtggccccagagctgccacgcc
gaatcccccgtgacgctcgcctctcatcagtgccactcgatggagttccactgtggcagc
ggagagtgcatccacggcagctggaagtgggatggagatgctgactgcttggatggatct
gatgaaactggctgcactcgctccacctgctgtccagatgagtttgaatgtggcgatgga
acctgcatccacggcagtcgccagtgcaaccagcagtacgactgcagagacacgactgac
gaatccggctgtgtcaacgtgacccgctgtgagggcccggacaagttcaagtgccgcagt
ggggagtgcataaccatggagagagtgtgtgacagcaaacgggactgcagggattggtca
gatgagcctcttcgggaatgtgaggcaccaacacctgcaggaccatcgcagtcagaatct
ccatccgcctccacaacccgtctgcctctcaggacgtcacctagagccacgttgaatccc
agactccaccacagcagcgccggtggtgatcaccagtaccacccccagggctgtaaccca
caccaccccaaggtcacagacacagaggaccaccaagccttcaatcaggagcaccatacc
actcccaaagaccactactcccaggctgatcgatctgaaagtcctgcagaccttcacaga
ggctccaaccacctctctggaaagcaaacgtgggcttggtgtgactctttactcggtcct
ccctctggcggttctctctctgttggctgttggtggcgtgctgctgtggaggaacttcag
gttgagaagctccaacaccatccactttcataa

DBGET integrated database retrieval system