KEGG   Oryzias latipes (Japanese medaka): 101157486Help
Entry
101157486         CDS       T02443                                 

Definition
(RefSeq) probable flap endonuclease 1 homolog
  KO
K04799  flap endonuclease-1 [EC:3.-.-.-]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola03030  DNA replication
ola03410  Base excision repair
ola03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ola00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101157486
   03410 Base excision repair
    101157486
   03450 Non-homologous end-joining
    101157486
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ola03032]
    101157486
   03400 DNA repair and recombination proteins [BR:ola03400]
    101157486
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ola04147]
    101157486
Enzymes [BR:ola01000]
 3. Hydrolases
  3.-  
   3.-.-  
    3.-.-.-  
     101157486
DNA replication proteins [BR:ola03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    101157486
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     101157486
DNA repair and recombination proteins [BR:ola03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     101157486
Exosome [BR:ola04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101157486
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: XPG_I XPG_N 5_3_exonuc XPG_I_2 HHH_5 DPRP
Motif
Other DBs
NCBI-GeneID: 101157486
NCBI-ProteinID: XP_004078686
LinkDB All DBs
Position
17
AA seq 343 aa AA seqDB search
MGITKLADLIRAEAPDSISHRDISDYAGKVIALDTSVVVNQFRAATPLSSPLRGLFFRTL
TFLEHDIKPVFVFDGKPPVEKLPLLEKRAEAAGWSRPLRTGIASSQTRDCLEVLKHLGVP
VVQAPGDAEGLCASLVREGRAHAVASEDMDTLPFGANVLIRQLNAKKDSEIVEYSLPKLL
EALRISLEELVDLCILLGCDYCDKIPGLGPKRALALIQKHRTIENVLLNINRETHPVPHL
WKFKESRQIFLDPPGPPTPELVWTEPDEEALVKFLRPIMKEERVRHRMETFREKRRDLRE
EREKEKAAGHCRQTRMVDFFRITRKRNQPVEPSSSGSKKTRSK
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgggcatcaccaaactggctgatctgatccgcgcggaggctcccgactcgatctcccac
agggacataagcgactatgcaggaaaagtcattgctctggatacttctgtggtcgtgaac
cagtttcgggctgcaacacctttgtccagccctctgagaggtctcttcttccgaacgctt
accttcctggaacatgacataaagccggtctttgtgtttgacggaaagcctccggtggag
aagcttcctctgctggagaagcgtgcagaggcagccggttggagccgtccgctgcgcaca
ggcatagcctcatcccagaccagagactgtctggaggtcctgaagcatctgggcgtacct
gtcgtccaggctccaggggacgctgaggggctgtgcgccagtctagtgagggaggggagg
gcccacgctgtggcctccgaggacatggacacgctgccgttcggagccaacgtcctcatc
cgccagctgaacgccaagaaggacagtgaaatcgttgagtattccttaccaaagctgctg
gaggcactccgcatcagtctagaggagcttgtggatctctgtattttgctgggctgcgac
tactgtgacaagatacctggtttgggtccgaagagagctctggctctgatccagaagcac
cgcaccattgaaaatgtgcttctgaacatcaacagagagactcatcctgtgccgcacctt
tggaaattcaaagagtccaggcagatcttcctggatccaccaggccccccgactccggag
ctcgtctggaccgagcccgatgaagaagccctggtgaagtttctccgtcccatcatgaag
gaggagagggtccgccatcgaatggagacgtttcgagaaaagcgaagagacctacgagag
gaaagggagaaggagaaggccgctggacactgcaggcagactcgcatggtcgacttcttc
agaatcacaaggaagagaaaccagcctgtggagccctcatcctcgggaagtaaaaaaacc
aggtcaaagtga

KEGG   Oryzias latipes (Japanese medaka): 101158562Help
Entry
101158562         CDS       T02443                                 

Gene name
fen1
Definition
(RefSeq) flap endonuclease 1
  KO
K04799  flap endonuclease-1 [EC:3.-.-.-]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola03030  DNA replication
ola03410  Base excision repair
ola03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ola00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101158562 (fen1)
   03410 Base excision repair
    101158562 (fen1)
   03450 Non-homologous end-joining
    101158562 (fen1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ola03032]
    101158562 (fen1)
   03400 DNA repair and recombination proteins [BR:ola03400]
    101158562 (fen1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ola04147]
    101158562 (fen1)
Enzymes [BR:ola01000]
 3. Hydrolases
  3.-  
   3.-.-  
    3.-.-.-  
     101158562 (fen1)
DNA replication proteins [BR:ola03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    101158562 (fen1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     101158562 (fen1)
DNA repair and recombination proteins [BR:ola03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     101158562 (fen1)
Exosome [BR:ola04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101158562 (fen1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: XPG_N XPG_I 5_3_exonuc HHH_5
Motif
Other DBs
NCBI-GeneID: 101158562
NCBI-ProteinID: XP_004081007
UniProt: A0A3B3HYK7
LinkDB All DBs
Position
20
AA seq 380 aa AA seqDB search
MGIHGLAKLIADHAPSAIKEQDIKSYFGRKIAIDASMCMYQFLIAVRQDGNVLQNEDGET
TSHLMGMFYRTIRMLEHGIKPVYVFDGKPPQLKSSELEKRGERRAEAEKLLAQAQEMGEQ
ENVEKFTKRLVKVTKQHNDECKKLLSLMGVPYIEAPCEAEASCAALVKEGKVFATATEDM
DGLTFGTNVLLRHLTASEAKKLPIQEFHFNRILQDMDLTKEQFIDLCILLGCDYCGTIKG
IGPKRAVDLIRQHGCIEEILENIDSKKHSAPEDWLYKEARGLFLKPEVVDCSSVELKWNE
PDEEGLVQFMCNEKQFSEDRIRNGCKKIVKSRQGSTQGRLDSFFTVTGSLSSKRKEPETK
GPAKKKQKTGATPGKFKKAK
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgggaatacacggacttgccaaactgattgctgaccatgccccttctgcaatcaaagag
caagacattaagagctactttggcaggaaaattgccatcgatgcctccatgtgcatgtac
cagttcctgattgctgtgagacaggatggtaatgttctacagaatgaagatggggaaaca
acaagccacctaatgggaatgttctaccgaacgatccgcatgctggagcatgggatcaag
ccggtgtacgtttttgatgggaagcctccacagctcaaatcatcagagcttgagaagaga
ggagaaaggagggcagaagctgagaagttgcttgctcaagcacaggaaatgggagaacaa
gaaaatgtagaaaaattcaccaaacgtctggttaaagtgactaagcagcataatgacgaa
tgcaaaaagctgctatccctgatgggcgttccttacattgaggctccatgtgaggctgaa
gccagctgtgctgctttagttaaagaagggaaggtctttgccacggcaacagaagacatg
gacggcctgacctttgggacaaacgtgctgctcagacatctcactgccagcgaagccaaa
aagcttcccattcaagagttccactttaatcgcatcttgcaggacatggacctgaccaaa
gagcagttcatcgatctgtgtattctgctgggttgcgactactgtggcaccatcaaggga
attggccccaagagagccgtggacctgatccgacagcacggctgcatcgaggagatccta
gaaaacatcgattcaaagaaacactcggccccagaggactggctgtataaagaggccagg
ggtctgtttctgaagccggaggtggtggattgttcctcggtggagctgaagtggaacgag
cctgatgaggagggcctggtccagttcatgtgcaacgagaaacagttcagtgaggacaga
atccgtaacggttgtaagaagattgtaaaaagcagacagggcagcacacagggaagactg
gactctttcttcaccgtcactggatccctgtcctccaaacgaaaggagccagaaacaaaa
ggaccagcaaagaaaaagcagaaaactggagcaacacctggaaaattcaagaaggccaaa
taa

KEGG   Oryzias latipes (Japanese medaka): 101159868Help
Entry
101159868         CDS       T02443                                 

Definition
(RefSeq) flap endonuclease 1-like
  KO
K04799  flap endonuclease-1 [EC:3.-.-.-]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola03030  DNA replication
ola03410  Base excision repair
ola03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ola00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101159868
   03410 Base excision repair
    101159868
   03450 Non-homologous end-joining
    101159868
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ola03032]
    101159868
   03400 DNA repair and recombination proteins [BR:ola03400]
    101159868
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ola04147]
    101159868
Enzymes [BR:ola01000]
 3. Hydrolases
  3.-  
   3.-.-  
    3.-.-.-  
     101159868
DNA replication proteins [BR:ola03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    101159868
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     101159868
DNA repair and recombination proteins [BR:ola03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     101159868
Exosome [BR:ola04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101159868
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 5_3_exonuc HHH_5 XPG_I
Motif
Other DBs
NCBI-GeneID: 101159868
NCBI-ProteinID: XP_011487108
LinkDB All DBs
Position
20
AA seq 164 aa AA seqDB search
MDLTKEQFIDLCILLGCDYCGTIKGIGPKRAVDLIRQHGCIEEILENIDSKKHSASEDWL
YKEARGLFLKPEVVDCSSVELKWNEPDEEGLVQFMCNEKQFSEDRIRNGCKKIVKSRQGS
TQGRLDSFFTVTGSLSSKRKEPETKGPANKKQKTATPGKFKKAK
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atggacctgaccaaagagcagttcatcgatctgtgtattctgctgggttgcgactactgt
ggcaccatcaagggaattggccccaagagagccgtggacctgatccgacagcacggttgc
atcgaggagatcctagaaaacatcgattcaaagaaacactcggcctcagaggactggctg
tataaagaggccaggggtctgtttctgaagccggaggtggtggattgttcctcggtggag
ctgaagtggaacgagcctgatgaggagggcctggtccagttcatgtgcaacgagaaacag
ttcagtgaggacagaatccgtaacggttgtaagaagattgtaaaaagcagacagggcagc
acacagggaagactggactctttcttcaccgtcactggatccctgtcctccaaacgaaag
gaaccagaaacaaaaggaccagcaaacaaaaagcagaaaacagcaacaccaggaaaattc
aagaaggccaaataa

KEGG   Oryzias latipes (Japanese medaka): 110017319Help
Entry
110017319         CDS       T02443                                 

Definition
(RefSeq) flap endonuclease 1-like
  KO
K04799  flap endonuclease-1 [EC:3.-.-.-]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola03030  DNA replication
ola03410  Base excision repair
ola03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ola00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    110017319
   03410 Base excision repair
    110017319
   03450 Non-homologous end-joining
    110017319
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ola03032]
    110017319
   03400 DNA repair and recombination proteins [BR:ola03400]
    110017319
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ola04147]
    110017319
Enzymes [BR:ola01000]
 3. Hydrolases
  3.-  
   3.-.-  
    3.-.-.-  
     110017319
DNA replication proteins [BR:ola03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    110017319
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     110017319
DNA repair and recombination proteins [BR:ola03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     110017319
Exosome [BR:ola04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110017319
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: XPG_I XPG_N MRPL52
Motif
Other DBs
NCBI-GeneID: 110017319
NCBI-ProteinID: XP_020568431
LinkDB All DBs
Position
20
AA seq 127 aa AA seqDB search
MGMFYQTIRMLEHGIKPVYVFDGKPPQLKSSELEKRGKRRAEAEKLLAQAQEMGEKENVE
KFTKRLVKVIKQHNDECKKLLSLMGVPYIEAPSEAEASCAALVKEGKVFATATEDIAGLT
FGTKVLF
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgggaatgttctaccaaacgatccgcatgctggagcatgggatcaagccggtgtacgtt
tttgatgggaagcctccacagctcaaatcatcagagcttgagaagagaggaaaaaggagg
gcagaagctgagaagttgcttgctcaagcacaggaaatgggagaaaaagaaaatgtagaa
aaattcaccaaacgtctggttaaagtgattaagcagcataatgacgaatgcaaaaagctg
ctatccctgatgggcgttccctacattgaggctccaagtgaagctgaagccagctgtgct
gctttagttaaagaagggaaggtctttgctacggcaacagaggacatagccggcctgact
tttgggacaaaagtgcttttctaa

DBGET integrated database retrieval system