KEGG   Oryzias latipes (Japanese medaka): 101157597Help
Entry
101157597         CDS       T02443                                 

Gene name
tk1
Definition
(RefSeq) thymidine kinase, cytosolic
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00240  Pyrimidine metabolism
ola00983  Drug metabolism - other enzymes
ola01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    101157597 (tk1)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    101157597 (tk1)
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     101157597 (tk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK Root_cap ATPase_2
Motif
Other DBs
NCBI-GeneID: 101157597
NCBI-ProteinID: XP_004066219
UniProt: H2MA53
LinkDB All DBs
Position
1
AA seq 223 aa AA seqDB search
MDVLDSSVLSNSPLKCRGQIQVIFGPMFSGKSTELLRRVRRFQVAQYKCLVIKYAGDTRY
SDTGVATHDKNTMEAIPANSLSDVRAAALKACVIGIDEGQFFPDTVEFSEEMANLGKTVI
VAALDATFQRKPFGNILSLVPLAESVVKLHAVCMQCYREAAYTKRIGVEKEVEVIGGADK
YQAVCRTCYGGQEDKENTRKTPIRAGKEVEASLPRKVFSHLHL
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggatgttttagattcgtcagtgctgtctaactcccccctgaaatgccgtggacaaatt
caagtcatctttggacccatgttttcaggaaaaagcactgagctgctgagacgtgtccgc
cgcttccaggtggctcagtacaaatgcctggtgatcaaatacgccggagacacacgttat
tccgacacaggagtggccacacatgacaaaaacaccatggaggccattcctgccaactct
ctgagcgacgttcgagctgcggcgttgaaggcctgcgtcattggaatcgatgagggacag
ttttttccagacactgtggagtttagtgaggagatggcgaatctggggaaaacggtcatt
gtagctgctttggatgcaaccttccagaggaagccgtttgggaacatcctgagcctggtt
cctctggcagagagcgtggtgaagctgcacgccgtctgcatgcagtgctacagagaagct
gcctacaccaagaggattggagtggagaaggaggtggaggtgattggaggagctgacaaa
taccaggcggtgtgcaggacgtgctatggaggacaagaggacaaagagaacacgagaaaa
actccaatcagagcaggaaaagaagtggaggccagtcttcctcggaaggtcttctcccac
ctccacctgtga

DBGET integrated database retrieval system