KEGG   Oryzias latipes (Japanese medaka): 101157857
Entry
101157857         CDS       T02443                                 

Gene name
casp9
Definition
(RefSeq) caspase-9 isoform X1
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
ola04210  Apoptosis
ola04370  VEGF signaling pathway
ola05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    101157857 (casp9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101157857 (casp9)
   04115 p53 signaling pathway
    101157857 (casp9)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101157857 (casp9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ola01009]
    101157857 (casp9)
   01002 Peptidases and inhibitors [BR:ola01002]
    101157857 (casp9)
Enzymes [BR:ola01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     101157857 (casp9)
Protein phosphatases and associated proteins [BR:ola01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101157857 (casp9)
Peptidases and inhibitors [BR:ola01002]
 Cysteine peptidases
  Family C14: caspase family
   101157857 (casp9)
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2
Other DBs
NCBI-GeneID: 101157857
NCBI-ProteinID: XP_011475124
UniProt: A0A3B3I9X6
LinkDB
Position
7
AA seq 438 aa
MEEKHKRILRRNRVHLVKELDLSDLCDVLLRKDVFTQSMINDIKNCETKRDQARKLVKDL
ETRGNEAFSAFLEGLRVTGQQNLLELLQKSAPRVHFQPGKSTEAGYLLIQPHPVYIEDAV
PKKPRTQPSPPPDEVFKGPEVRPRRDSIQYYKMDARPCGLCLIINNVEFEPKTELSIRKG
SNVDCDKLEKRFKSLNFVVEVRTNLKQRQIKSELSALSRKDHSIYDCCVVVILSHGTEVR
HNKIRSAGSWIEIDQVSHNRFPGAVYGVDGNHVSVQEITNYLNGQNCPSLQSKPKIFFIQ
ACGGGEKDIGFEVSPDEAKPSIGGDGDQTDAIPFSSSSESLSTSDETDAIPTLPTPSDIL
VSYSTFPGYVSWRATVSGSWYVEVLDNILEEHAATLDLTTMLTLVNDKVSQNSAKGLYKQ
MPGSFNFLRKHVYFQTSE
NT seq 1317 nt   +upstreamnt  +downstreamnt
atggaagaaaaacacaaaaggatccttcgccgaaaccgagttcatctggtaaaggagttg
gacctgtcggacctctgtgatgttctccttagaaaagacgtgttcacccaaagcatgata
aacgacataaagaactgtgagaccaaacgggaccaggcccgaaaattggttaaggactta
gagacccgcgggaatgaggcgttttcggcttttctggagggccttcgggtcacgggtcag
cagaatctgctggagctactccagaaatcagctccaagagtccatttccagcctgggaaa
tccacggaggcgggataccttctaatccagcctcatccagtttacattgaagatgctgtt
ccaaagaagcccaggacccaacctagtccaccacctgacgaggtgttcaaggggccagag
gtccgaccacgacgggacagcatccagtactataagatggatgccaggccatgcggtctt
tgtcttatcataaacaacgtggaatttgagccaaaaactgagctcagcattcgcaaagga
tccaacgtggactgtgacaagctagagaaacgattcaagtcgcttaacttcgtggtggaa
gtccggacaaatctgaaacaaaggcaaatcaaatctgagctgtcagctttgtccaggaag
gatcattccatttacgactgctgtgtggtcgtcatactctcacatgggacagaggtccgc
cacaacaagatcagatcagctgggagctggatagaaatagaccaggtgagccacaaccgc
ttcccaggtgcggtctacggtgtggatggaaatcacgtctcagttcaggaaatcacaaac
tacctcaatggccagaactgcccctccttacaaagcaaacccaaaattttcttcatccag
gcctgtggtggaggggaaaaggacattggctttgaggtttcccctgatgaggctaaaccc
tccattggtggagatggggaccaaacagacgccattcctttttcatctagcagcgagtct
ctgagcacgtcggatgaaactgatgccataccaacgctgcccacccccagcgacatcctg
gtctcttactctactttccctggctacgtttcctggcgagctacagtctcaggatcctgg
tatgtggaggttctggacaacattctcgaggaacatgctgcaactctagacctgacaaca
atgttgacgttggtaaacgataaggtttcccaaaactctgcaaaaggcctctacaaacaa
atgcctggctccttcaatttcctccgcaagcacgtctacttccaaacctcagagtaa

DBGET integrated database retrieval system