KEGG   Oryzias latipes (Japanese medaka): 101158302Help
Entry
101158302         CDS       T02443                                 

Gene name
setdb1
Definition
(RefSeq) histone-lysine N-methyltransferase SETDB1
  KO
K11421  histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101158302 (setdb1)
Enzymes [BR:ola01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101158302 (setdb1)
Chromosome and associated proteins [BR:ola03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101158302 (setdb1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    101158302 (setdb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET MBD 53-BP1_Tudor
Motif
Other DBs
NCBI-GeneID: 101158302
NCBI-ProteinID: XP_011483641
LinkDB All DBs
Position
16
AA seq 1238 aa AA seqDB search
MENVEGMEVDGWDSSLEEEFGISLDELKKWIDEAVEKSDIVQKKKAQLTELKEWVEQKEE
EEAKTEMLLTDANQSVIECEKLVKEACKKNGLVYRESGSEDEGGGGGSLPSEVIEIDDDD
DDDVIAVGCLVPPNKTLTPSKDPALKEASAVLQKTSHQVQKLVQIVAKSPASAALLRSPT
QLSAPSGIQSSAPAVFVSQAPSQGMTQPSPNIKEDELKIGMNILGKKRTKTWHRGTLVAI
NPIGGGVYKYKVKFDKGKSLLSGNHVAFDYNPTLESLFVGARVVAKYKDGNLVWLYAGIV
AEMPNNKNRMRFLIFFDDGYASYVILPELYPVCRPLKHTWEDIEDASCRDFIEEYISAYP
SRPMVLLKAGQIIKTEWEGTWWKSRVEEVDGSLVKILFLDDKRSEWIYRGSTRLEPMFNL
KMTTANTHEKKLAGQQRTRPNMGALRTKGPVVQYTGVEHVGGSPVKSPQPPSTEPVTPQP
QPSPQPQQPQPIAQNTQPPQPPQPPRVENKTQMAKKSTSPFVPGVGGTHASKILQSLTPT
STNIASAKILSPAVTPQSNFSSLYPRPLPTTPPAPPPMPHVVATIPTQASYRAPTDRIFY
LAHTCQPACLNRVRPVKPDIHRGKNPLLTPLLYDFRRMTGRRKVNRKMSFHVIYKAPCGL
CLRNMPEIQNYLFQTRCDFIFLEMFCLDPYVLVDRPFQPQRPFYYIPDITGGKEDIPLSC
VNEIDNTPPPKVKYSKERIPEDGVFINTSDDFLVGCDCTDGCRDKSKCSCHQLTLQATAC
TPGAQINPNAGYLHKRLEECLPTGIYECNKRCKCCAQMCTNRLVQHGLQVRLQLFKTQNK
GWGIRCLDDVAKGSFVCIYAGKILTDDFADKEGLEMGDEYFANLDHIESVENFKEGYESE
AHCSDSEGSGVDLSRMKIQPSALVSSSSGGRHPRKARNSSSTTDSNDDEDKDSKSEDESD
SSDDTFVKENFYTSSSVWRSYTTRGQLKGNKEGSQDSKDGLSLTCREKGDDNPPAMPEET
GKSKVAFWLTSQGLKKDTGDGKSQAKSEPGKKQDVMTLSDSDDVQTISSGSEDNKEKEKV
PTGVPKKQVAVKSTRGIALKNSHSMMVKTGSGGGGGGGGAGGQGGKAGTSGQTTGGGENA
PKNTRLFFDGEESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASK
RIRAGTELTWDYNYEVGSVEGKELLCCCGSTECRGRLL
NT seq 3717 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacgttgaaggaatggaggtggatggctgggactccagtctggaggaagagttt
ggcatatccctggatgagctgaagaaatggattgatgaagctgtggaaaagagcgacatt
gtccagaagaagaaagctcagctgacggagcttaaggaatgggtggagcagaaagaggaa
gaggaggcaaagacggagatgctgcttactgatgccaaccagtctgtaatagagtgtgag
aagctggtgaaggaagcttgtaagaagaatggtcttgtttatcgtgagagcggctccgag
gatgagggaggcggaggaggttccctgccctctgaagttatagagatagacgacgatgat
gacgacgacgttattgctgttggttgtttggttcccccaaacaagacattaaccccctct
aaagaccctgcgttaaaggaagcctctgcagttctgcagaaaacctcccaccaagttcag
aagttggtccaaatagtcgccaagtctccagcatctgctgcgttgcttcgatctccaaca
cagctctctgctccttcaggtattcaaagctcggcaccagcagtgtttgtgtctcaggcc
ccatcccaaggaatgactcagccgagcccaaacataaaagaagatgagctcaaaattggg
atgaacattctgggaaagaaacgcacgaagacctggcacagaggcactcttgttgccatc
aaccctattggaggtggggtttacaaatacaaagtaaagtttgataaaggcaagagtctg
ctgtcgggaaaccatgtggctttcgactacaaccccactctggagagtctgtttgttggg
gctcgagtagttgccaagtacaaagatggcaacctggtgtggctgtatgcaggaatcgta
gcagaaatgcccaacaacaagaaccgcatgaggttcttgatcttcttcgatgatggctat
gcttcctatgtgatacttcctgaactttaccctgtttgcagacctttaaaacacacttgg
gaggacatagaagatgcttcttgtcgagactttatcgaggagtatatctctgcctatccc
agcaggccgatggtgctcctcaaggccggccaaataatcaagacggagtgggaaggaact
tggtggaagagcagggtggaggaagtggatggcagcttggtcaagattctctttttagat
gataagaggagtgagtggatctacagaggatccaccaggctggagcctatgttcaacctg
aaaatgaccacagctaacacccatgaaaagaagctggctgggcagcagaggacgagaccc
aacatgggagctttgcggactaaaggcccggtagttcagtacacaggggtggaacatgtt
ggaggttctcctgttaaaagcccacagcccccatctactgaacctgtgaccccacagcct
caaccaagtccacaaccacagcaacctcaaccgattgcacagaacactcagcccccacag
cccccccagcctccacgtgtggagaataaaactcagatggcaaagaagagtacgtctcca
tttgtgcctggagttggaggcacacacgcttccaaaatcctgcagtctttgacccccact
tccactaatattgcaagtgcaaaaattctgagtcctgcagttactcctcagtccaatttt
tcctcgttgtatccgagaccgcttcccaccacacctcctgccccccctcccatgccgcat
gtggtggccaccattcccacacaggcctcgtacagagccccaacagaccgcatcttttac
ctggcccatacgtgtcagcctgcctgtctgaaccgggtccgaccagtaaaaccagacatc
cacagaggcaagaaccccctcctcacacctttgctgtatgatttcagacgcatgacagga
cgccgtaaagtcaatcggaagatgtctttccacgtgatctacaaggctccatgtggactt
tgtctgcgcaacatgccagagattcagaactacctcttccagacccgctgtgactttatc
ttcttggagatgttctgcctcgatccctatgtgctggtggaccgccctttccagccgcag
aggcccttttattacattccagatatcactggtgggaaggaggacatccctctttcatgc
gtgaacgagatcgataacactccgcctcctaaagtcaaatacagtaaagagcgtattcca
gaagatggagtattcatcaacaccagcgatgacttcctagttgggtgcgattgcaccgat
ggctgtcgagacaagtccaaatgttcctgccaccagctgactcttcaagccacagcttgc
acaccaggggcgcagatcaacccaaacgctggatatttgcacaagcgattagaggagtgt
ctgcctacagggatctacgagtgtaataagaggtgcaaatgttgtgctcagatgtgcacc
aacaggctggtgcagcacggcctgcaggttcgtcttcaactcttcaaaacgcagaacaaa
ggctggggcatccggtgtctggatgatgtggccaaaggctcattcgtctgcatttatgct
ggtaaaatcctgacggacgattttgccgacaaagaaggtctggaaatgggcgatgagtat
ttcgccaacctagaccacattgagagcgtggagaacttcaaggagggctacgagagcgag
gcccactgctcagacagcgagggaagtggcgttgacctttccaggatgaaaatccagcca
tccgcgttagtgtcgagtagcagcggggggcgacatcccaggaaggctcgcaactcaagc
tcaaccactgatagcaatgatgacgaggacaaagattcaaagagtgaagacgaaagtgac
agttcagatgacacttttgtcaaagaaaacttctacacttccagttccgtgtggaggagc
tacacaacacgcggccagctgaaaggcaacaaagaagggagtcaggacagtaaagatgga
ttgagcctcacatgcagagagaaaggtgatgataaccccccagccatgcctgaggagacg
ggcaaaagcaaagtagctttttggctaacgagccaggggctcaagaaggacaccggagat
ggcaagagtcaagcaaaatcagaaccaggaaagaagcaggatgtgatgactctctcagac
agtgatgatgtccaaaccatcagctctggatcagaagacaacaaagagaaggagaaagtt
cctacaggtgtgccaaagaagcaggtggcagtaaagtccactcgaggcatcgccttgaaa
aacagccacagtatgatggtaaaaaccggttcaggcggaggaggaggaggaggaggagca
ggaggccagggggggaaagctgggacgtcaggacaaaccacaggaggcggagaaaatgct
cccaaaaacactcggctgttcttcgatggcgaagagtcctgctacatcattgatgccaag
ttagaaggaaatctcggacgttatctgaaccatagctgcagtccaaacctatttgtccag
aatgtgtttgtggacactcatgacttgcggttcccctgggtggctttctttgccagcaaa
cgaatccgggccggtaccgagctgacatgggactacaactatgaagtgggcagcgtggag
ggaaaagagctgctctgctgctgcggctccacagaatgcagaggaagattgctgtga

DBGET integrated database retrieval system