KEGG   Oryzias latipes (Japanese medaka): 101158322Help
Entry
101158322         CDS       T02443                                 

Gene name
abat
Definition
(RefSeq) 4-aminobutyrate aminotransferase, mitochondrial
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00250  Alanine, aspartate and glutamate metabolism
ola00280  Valine, leucine and isoleucine degradation
ola00410  beta-Alanine metabolism
ola00640  Propanoate metabolism
ola00650  Butanoate metabolism
ola01100  Metabolic pathways
Module
ola_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    101158322 (abat)
   00650 Butanoate metabolism
    101158322 (abat)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101158322 (abat)
   00280 Valine, leucine and isoleucine degradation
    101158322 (abat)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101158322 (abat)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ola01007]
    101158322 (abat)
Enzymes [BR:ola01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     101158322 (abat)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     101158322 (abat)
Amino acid related enzymes [BR:ola01007]
 Aminotransferase (transaminase)
  Class III
   101158322 (abat)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-GeneID: 101158322
NCBI-ProteinID: XP_023813644
LinkDB All DBs
Position
8
AA seq 500 aa AA seqDB search
MATSLIRRQLAVPLQRTLCLRAPGCRFVSKTAAKTHVEFDYDGPSMKTSVPGPRSQELLK
QLGEIQNVGAVNFFCNYDDSRGNYLVDVDGNRMLDLYTQISSIPIGYNHPALLKLMANPN
NLSTFVNRPALGILPPENFPDKVTESLLSVAPSGMSRVQTMSCGSCSNENAFKSIFIWYR
NKERGLSGPTAEDLSSCMLNQAPGCPDLSILSFTGAFHGRTMGCLATTHSKAIHKLDVPS
LDWPIAPFPRLQYPLEEFSRENEQEEARCLEEVEDLIVKWRQKGKPVAGIVIEPIQSEGG
DNHATADFFRKLRIIAQKHGCGFLVDEVQTGGGGTGKFWAHEHWGMDDPADIVSFSKKLM
TGGYFHKDELQADKPYRIFNTWMGDPSKNLFLAEVLNVIRRENLLEEVARSGKALMNGLY
ELQAQYPGLLSRARGQGTFCAIDVRDAETRERITLQTRDKGVILGGCGEKSIRFRPALIF
KEYHVHLFLNIFNDVLAQHK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggccacgtccctcatccgccgccagctcgccgtgccgctgcagaggaccctgtgcctc
cgagctccaggatgcagatttgtgagcaagactgcagccaaaacacacgtggagtttgac
tacgatggaccgtccatgaagaccagcgtccccggaccgcgctcccaggagctgctgaaa
cagctcggagagattcagaacgtgggcgccgtcaatttcttctgcaactacgatgacagc
aggggaaactacctggtggacgtggacggcaaccgcatgctggacctctacacccagatc
tcctccatccccattggctacaaccatcctgctctcctcaagctcatggccaaccccaac
aatctgagtacgtttgtgaatcgccccgccctgggaatcctgccccccgagaacttcccg
gacaaagtgacggagagccttctctctgtggcccccagtgggatgagccgagtccagacg
atgtcctgcgggtcgtgctccaatgagaacgccttcaagtccattttcatctggtaccgg
aacaaggagcgcggcctgagtggacccacggctgaagacctgagctcctgcatgctgaac
caggctccaggatgccccgatctcagtattttgtctttcacgggagctttccacggaaga
acgatgggttgcctggcaacgacgcattccaaagccattcacaagctggatgtgccgtcc
ctggactggcccatcgccccgtttccgaggctgcagtatcctctggaggagttcagcagg
gagaacgagcaggaggaggcccgctgcctggaggaggtggaggacctgatcgtgaagtgg
aggcagaagggaaaacctgttgcaggcatcgtgatcgagcccatccagtctgagggcgga
gacaaccacgccaccgcagacttcttcaggaaactccgcatcatcgctcaaaagcatggc
tgtggcttcctggtggatgaggtccagaccggtggaggaggcacaggaaagttctgggcc
catgagcactggggcatggacgaccccgctgacatcgtctccttcagcaagaagctcatg
acgggggggtacttccacaaggacgagctgcaggctgataagccgtaccgcatcttcaac
acatggatgggggacccgtccaagaacctgttcctggctgaagtcctgaacgtgatccgc
agagagaacctcctggaggaggtggcccgctccgggaaagcgctgatgaacggcctgtat
gagctgcaggctcagtacccgggcctgctgagccgggctcgagggcaggggaccttctgc
gccatcgatgttcgtgacgctgagacccgtgagaggatcacgctgcagaccagagacaaa
ggggtcatcctcggaggatgtggagagaaatccatccgtttccgtccggcgctgatcttc
aaggagtaccacgtccacctcttcctcaacatcttcaacgacgtgctggcccagcacaaa
tag

DBGET integrated database retrieval system