KEGG   Oryzias latipes (Japanese medaka): 101158492Help
Entry
101158492         CDS       T02443                                 

Gene name
pygl
Definition
(RefSeq) glycogen phosphorylase, liver form
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00500  Starch and sucrose metabolism
ola01100  Metabolic pathways
ola04217  Necroptosis
ola04910  Insulin signaling pathway
Module
ola_M00855  Glycogen degradation, glycogen => glucose-6P
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101158492 (pygl)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101158492 (pygl)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101158492 (pygl)
Enzymes [BR:ola01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     101158492 (pygl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphorylase
Motif
Other DBs
NCBI-GeneID: 101158492
NCBI-ProteinID: XP_004082115
UniProt: H2LYL1
LinkDB All DBs
Position
22
AA seq 853 aa AA seqDB search
MATPLTDQEKRKQISIRGIVGVENVAELKKGFNRHLHFTLVKDRNIATPRDYYFALAHTV
RDHLVGRWIRTQQFYYEADPKRVYYLSLEFYMGRTLQNTMINLGLQNACDESIYQLGLDM
EELEEMEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEYGIFNQKIRDGWQVEEA
DDWLRHGNPWEKARPEYTLPVHFYGRVVETKDGPKWVDTQVVLAMPYDTPIPGYMNNTVN
TMRLWSARAPNDFNLKDFNVGDYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFV
VAATLQDIIRRFKTTKKGVPGRTSFESFPNKVAIQLNDTHPAMAIPELMRVFVDIEKLDW
DTAWDLTRRTFAYTNHTVLPEALERWPVQLLENLLPRHLQIIYQINQTHLDKIAALFPKD
MDKLRKMSLIEEDGCKRVNMAHLCIVGSHAVNGVAEIHSNIIKTQVFRDFSELEPGKFQN
KTNGITPRRWLLLCNPGLAELIAEVIGEDYVKDLSQLRKLNDFVNNAAFIRDVSKVKQDN
KLKFAQYLEKEYRVKINLASMFDVHVKRIHEYKRQLLNCLHIIALYNRIRKNPAAPFVPR
TVIIGGKAAPGYYMAKMIIKLITSVADVVNNDPVVGSKLKVIYLENYRVSLAEKVIPATD
LSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRVEEVAEM
DKKGYDAMAYYNKIPELKHVMDQITSGFFSPKNPDLFKDLTEMLFKHDRFKVFADFEDYM
KCQEKVSQLYQNPVEWTKMVIRNIAGTGKFSSDRTITEYATEVWGVEPTDLKIPPPNEPR
EAIEETVRALKKM
NT seq 2562 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccccactgacggaccaggagaagcggaagcagatcagcatcaggggcatcgtg
ggggtggagaacgtggcggagctgaagaagggcttcaaccgccacctgcacttcacgctg
gtcaaggaccggaacatcgccacgcccagagactactacttcgcgctggcccacaccgtc
cgggaccacctggtgggcaggtggatccggacgcagcagttctactatgaggcggacccg
aagagggtctactatctgtccctggagttctacatgggccggactctgcagaacaccatg
atcaacctggggctgcagaacgcctgcgacgagtccatctaccagctcggcctggacatg
gaggagctggaggagatggaggaggacgcggggctggggaatggaggtctgggcagactg
gcagcctgcttcttggactccatggccaccttgggtctggcggcttacggctacggcatc
cggtatgaatatgggatcttcaaccagaagatcagagacggttggcaggtggaggaagcg
gatgattggctgaggcacggaaacccctgggagaaggcccgtcccgagtacacgctgccg
gttcacttctatggacgcgtggtggagaccaaggacgggcccaaatgggtcgatactcag
gttgttcttgcaatgccgtacgacacgcccatacctggctacatgaacaacaccgtgaac
acaatgaggctgtggtcggcgcgagcgcccaatgacttcaacctgaaggacttcaatgtt
ggagattacatccaggctgttctggacaggaatctggcagagaacatttcccgtgttctc
tatccaaatgacaatttctttgaaggaaaagagcttcgtctgaagcaggagtactttgtc
gtagcagccacactccaagatatcatccggcgcttcaagaccaccaagaaaggagttcct
ggtcgcacctcctttgagagtttccccaataaggtcgccattcagctgaacgacactcat
cccgccatggccatcccagagctgatgagggtctttgtggacatcgagaagctggactgg
gacacggcgtgggacctgaccagacgcacctttgcctacacaaaccacacggtcctcccc
gaggctctggagcgctggcccgtgcagctcctggagaacctcctccccagacacctgcag
atcatctaccagatcaaccagacccacctggataaaattgctgctctgtttccgaaagac
atggacaagctgaggaaaatgtctttgatcgaggaggacggctgcaagagggtgaacatg
gcgcacctgtgcatcgtgggctcccacgccgtgaatggagtcgctgagatacactccaac
atcatcaagacccaagtatttcgtgacttcagcgaactggagcccgggaagtttcaaaat
aaaaccaacggcatcactcccagacgctggctgctgctctgcaacccgggactggctgag
ctcatcgctgaggtgatcggggaggattacgtgaaggacctcagtcagctcaggaagctg
aacgactttgtgaacaacgccgctttcattcgcgacgtctctaaagtcaagcaggacaac
aagctgaagttcgcccagtacctggagaaggagtacagggtcaaaatcaacctggcgtcc
atgttcgacgtccacgtgaagaggatccacgagtacaagcggcagctgctcaactgcctg
cacatcattgccttgtacaaccgcatcagaaagaaccccgccgcccctttcgttccccgg
acggtgatcatcggtggaaaggctgcccccggctactacatggccaaaatgatcatcaag
ctcatcacctcggtggccgacgtggtgaacaacgaccccgtggttggaagcaagctgaag
gtcatctacctggagaactacagggtttccctggcagagaaagtgattccagccactgat
ttatcggagcagatctccaccgccggcaccgaggcctcaggaacgggcaacatgaagttc
atgctgaacggagccctgaccatcggcaccatggacggcgccaacgtggagatggccgag
gaggccggggaggagaacctcttcatctttgggatgagggtggaggaggtggccgagatg
gacaaaaagggatacgacgccatggcgtactacaacaagatccctgagctgaaacacgtg
atggaccagatcaccagtggattcttcagccccaaaaacccagacctcttcaaagatctg
acggaaatgctcttcaaacacgatcgcttcaaggtgtttgcagactttgaagactacatg
aaatgtcaggaaaaagtcagccaactttaccagaacccagtggagtggaccaagatggtg
atcaggaacatcgccggcacggggaagttctccagtgacagaaccatcacggagtacgcc
acagaggtgtggggggtggagcccaccgacctgaaaatcccgccgccaaacgagcccaga
gaggccatcgaggagacggtccgggcgctgaagaagatgtga

KEGG   Oryzias latipes (Japanese medaka): 101169133Help
Entry
101169133         CDS       T02443                                 

Definition
(RefSeq) glycogen phosphorylase, muscle form
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00500  Starch and sucrose metabolism
ola01100  Metabolic pathways
ola04217  Necroptosis
ola04910  Insulin signaling pathway
Module
ola_M00855  Glycogen degradation, glycogen => glucose-6P
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101169133
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101169133
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101169133
Enzymes [BR:ola01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     101169133
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphorylase COX_ARM
Motif
Other DBs
NCBI-GeneID: 101169133
NCBI-ProteinID: XP_004076418
UniProt: H2LNH1
LinkDB All DBs
Position
14
AA seq 841 aa AA seqDB search
MSKPLSDHDRKKQISVRGLAGVENVSELKQNFNRHLHFTLVKDRNVATRRDYYFALAHTV
RDHLVGRWIRTQQHYYEKDPKRVYYISLEFYMGRTLQNTMVNLALENACDEAMYQLGLDM
EELEDMEEDAGLGNGGLGRLAACFLDSMASLGLAAYGYGIRYEFGIFNQKIVNGWQVEEA
DDWLRYGNPWEKARPEYMRPVHFYGRTEHHPDGARWVDTQVVLALPYDTPVPGYRNNYVN
TMRLWSAKAPCDFNLKDFNVGGYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFV
VSATLQDIIRRFKVSKFGSREIARTDFSKLPDKVAIQLNDTHPAMAIPELMRVLVDEEKL
PWETAWDICVRTCAYTNHTVLPEALERWPVDLFAHLLPRHLEIVYEINRRHLERVAAKYP
GDNGRLCRMSLIEEGGQKRINMAHLCIVGSHAVNGVAQIHSDILKATVFKDFYEMEPHKF
QNKTNGITPRRWLVMCNPGLAEVIAEKIGEDFIRDLDQLQALRNFVNDEAFIRDVAKVKQ
ENKMKFAVHLEEHYKVKINRDSMFDVQVKRIHEYKRQLLNCLHMITYYNRIKKEPSKQWT
PRTVMIGGKAAPGYHTAKMIIRLITAIGEVINNDPIVGDRLKIIFLENYKVTLAEKVIPA
ADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEDNLFIFGMRVDDVD
ALDRKGYNAEEYYSRLPELKQAIDQIAGGYFSPKQPDLFKEIVNMLMHHDRFKVFADYED
YIKCQEKVNALYKNPKEWTKKVIYNIAGCGKFSSDRTIAQYAREIWGMEPTLERLAAPDD
I
NT seq 2526 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagcctctatccgaccacgacaggaagaaacagatctccgtgcgcggcctggct
ggtgtggagaacgtctcagagctgaagcagaacttcaacaggcatctccactttaccctg
gtcaaggacaggaatgtggccacccgaagggattattactttgcccttgcccacacagtg
cgtgaccacttggtcggcaggtggatcagaacccagcagcactactatgagaaagatccc
aagagggtttactacatctccttggagttctacatgggccgcaccctccagaacaccatg
gtgaacctggcactggagaacgcctgcgatgaggccatgtaccagctgggtttggacatg
gaagaactagaggacatggaggaagatgctggtttggggaacggaggccttggtcggctt
gctgcctgtttcttggactcaatggcctcactgggtttggctgcctatggttatggcatt
cgctacgaatttggtatcttcaatcagaaaatcgtcaacggctggcaggttgaagaggcc
gatgactggctgcgctacggtaacccctgggagaaggctcgtcctgaatacatgcgtcct
gttcacttttacggcaggacggagcaccaccctgatggtgccagatgggtggacactcag
gtggtgttggccctgccgtacgacacgcctgttccaggttacaggaacaactacgtgaac
accatgaggctttggtctgcaaaggcgccatgcgatttcaacctcaaagactttaatgtt
ggaggctacattcaggctgttttggacagaaacttggctgagaacatctcccgtgtgctc
taccccaatgacaatttctttgaagggaaggagctccgtctgaagcaggaatactttgtg
gtgtctgccaccctgcaagacattattcgccgcttcaaggtctccaagtttggctccaga
gagattgctcgcacagacttcagcaagctgcctgacaaggttgcaatccagctcaatgac
actcaccccgccatggccatcccagagctgatgagggttttggtcgatgaggagaaactc
ccatgggaaacagcttgggatatctgcgtgcgcacctgtgcatacaccaaccacaccgtc
ctgcctgaagccctggagcgctggccggtggacttgtttgctcatctgcttcctcgacac
ctggagatagtctatgagatcaaccggcgccacctggagagagtcgctgctaagtatcca
ggagacaacggccgcctttgccgcatgtccctcattgaggaaggtggacagaagaggatc
aacatggcccatttgtgcatcgtgggctcccatgctgtcaacggagtggcccagatacac
tctgacatccttaaagctactgttttcaaggacttctatgaaatggagcctcacaagttc
caaaacaagaccaacggcatcactcctcgccgctggcttgttatgtgcaacccagggttg
gctgaggtcatcgctgagaaaatcggggaggacttcattcgtgaccttgaccagctccag
gctctccgcaactttgtgaacgatgaagctttcattcgggatgtggccaaagtcaaacag
gagaacaagatgaagttcgcggttcacctggaggaacactacaaggtgaagatcaaccgc
gactccatgttcgacgtccaagtcaagagaatccatgagtacaagagacagctgctcaac
tgtctgcacatgatcacctattacaaccgcatcaagaaggaacccagcaagcagtggact
ccaagaaccgtcatgattggaggaaaggctgcacctggataccacacggccaagatgatc
atccgtttgatcacagccatcggtgaagtgatcaacaacgaccccatagtgggggatcgc
ctgaagatcattttcctggagaattacaaagtcacgctggcagagaaagtcatcccggct
gctgatctgtccgagcaaatttctactgctggcaccgaagcatccggcaccggcaacatg
aagttcatgttgaatggggcgctgaccattggtaccatggatggagccaatgttgagatg
gcagaggaggcaggtgaagataacctcttcatctttggcatgagggttgatgacgttgat
gcgctggacaggaaaggatataatgctgaagagtactacagccgcctgcctgaactaaaa
caggcaattgaccagattgctggaggctactttagcccaaaacagcctgacctgtttaag
gaaattgtcaacatgttgatgcatcatgacaggttcaaggtctttgctgactatgaagac
tacatcaaatgccaagaaaaagtcaatgcgctctacaagaaccccaaggaatggaccaag
aaggtaatctacaatatcgcaggatgtggaaagttctccagcgatcgcaccatcgcccag
tatgctcgggagatttggggcatggagcccacgcttgagaggctggcagcccctgacgac
atataa

KEGG   Oryzias latipes (Japanese medaka): 101170949Help
Entry
101170949         CDS       T02443                                 

Gene name
pygb
Definition
(RefSeq) glycogen phosphorylase, brain form isoform X1
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00500  Starch and sucrose metabolism
ola01100  Metabolic pathways
ola04217  Necroptosis
ola04910  Insulin signaling pathway
Module
ola_M00855  Glycogen degradation, glycogen => glucose-6P
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101170949 (pygb)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101170949 (pygb)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101170949 (pygb)
Enzymes [BR:ola01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     101170949 (pygb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphorylase
Motif
Other DBs
NCBI-GeneID: 101170949
NCBI-ProteinID: XP_004077055
UniProt: H2LCC8
LinkDB All DBs
Position
15
AA seq 847 aa AA seqDB search
MAAPVTDHERRKQISVRGIAGLADVTEIKRTFNRHLHFTLVKDRNVATPRDYYFALAHTV
RDHVVGRWIRTQQNYYEKDPKRVYYLSLEFYMGRALQNTMINLGLQNACDEAIYQLGLDL
EELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEFGIFNQKICNGWQVEEA
DDWLRYGNPWEKARPEYMLPVHFYGRVQATESGMQWTDTQVVLAMPYDTPVPGYHNNTVN
TMRLWSAKAPDDFNLQNFNVGDYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFV
VAATLQDIIRRFKSSKFGSREPVRTSFETFPDKVAIQLNDTHPALAIPELMRVLVDLEKL
DWDKAWDITCRTCAYTNHTVLPEALERWPVYMFEQLLPRHLQIIYEINQRHLDRTAALFP
GDVDRLRRMSLIEEGDPKRINMAHLCVVGSHAVNGVAQIHSDIVKNTVFKDFYQVDPDKF
QNKTNGITPRRWLLLCNPGLADIIAERIGEDFLTDLYQLKNILQFVDDEAFIRDVAKVKQ
ENKLKFAAFLQKHCQVKVNPESIFDVQVKRIHEYKRQLLNCLHAITLYNRIKLRPERAFV
PRTVMIGGKAAPGYHMAKMIIKLITSVGEVVNNDPAVGDKLKVIFLENYRVSLAEQVIPA
ADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGATVEMAEEAGEENLFIFGLKVAEVD
ELDRKGYNAKEYYDSLPELKLAVDQIQRGYFSPSEPELFREVTEMLMKHDRFKVFADYEA
YVKRQEQVSELYENPREWTKVVIRNIAAAGKFSSDRTISQYAREIWGVEPSNIKLPSPNE
PLMKSQS
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgccggtgacagaccacgagaggcggaagcagatcagcgtgcgcgggatcgcg
gggctcgcggacgtgacggagatcaaacggacttttaatcgacacctgcacttcacgctc
gtgaaggaccggaatgtggccacgccccgcgactactactttgccctggcccacacggtc
cgggaccacgtggtgggccgatggatacgaacccagcagaactactacgaaaaggacccg
aagagggtctactacttgtccctggagttttacatggggcgagctctgcagaacactatg
atcaatctgggcctgcagaacgcctgcgatgaagccatttaccagctgggtttggacctt
gaagagttggaagagattgaagaggatgctggtctgggaaatggtggacttggccgcctg
gcagcttgtttcctggactccatggcgactctcggtttggctgcgtacggatacgggatt
cgctacgagtttgggatcttcaatcagaaaatctgcaatggatggcaggtagaagaggca
gatgattggctgcgatatggaaacccctgggagaaggcgaggcccgagtacatgctgccg
gttcacttctatggtcgagtgcaggcgacggagagcgggatgcagtggactgacacgcag
gtggtactagcgatgccctacgacactccagtccctggttaccataacaacacggtcaac
accatgaggctctggtcggctaaagcgcctgacgactttaacctgcagaactttaacgtt
ggagattacattcaagccgttctggaccggaacctggctgagaacatctccagggttctg
tatcctaacgacaacttttttgaggggaaagagcttcgcctgaagcaggagtattttgtg
gtggccgccacgctgcaggacatcatccgcaggttcaagtcttcgaagtttggctccaga
gagccggtccgcacgtccttcgaaacatttcctgacaaggtggctatccagctgaacgac
acccacccagctctggcgatccctgagttgatgcgggtcctggtggacctggagaagctg
gactgggacaaggcgtgggacatcacctgtcgtacctgcgcgtacaccaaccacacggtg
ctgccagaggcgcttgagcgttggcctgtttacatgttcgagcagctgctgccccgacat
ctgcagatcatctatgaaatcaaccagaggcacctggataggacagccgcgctgtttcca
ggcgacgtagaccgtctgcggcggatgtctctcattgaggagggggacccgaaaaggatc
aacatggctcatctgtgcgtagtcggatcccacgccgtcaacggagtggcgcagatccac
tcagacatcgtcaagaatacagtgtttaaagacttttaccaggtggatccagacaagttc
cagaataaaaccaacggcataactcctcgccgctggctattgctgtgtaatcccggcctg
gctgacatcatcgctgagaggataggagaagacttcctgacagacctatatcagctgaag
aacatcctacagtttgtggacgatgaagccttcatcagggatgtggccaaagtcaaacag
gaaaacaagctgaagtttgctgcattcctgcagaagcactgtcaggtgaaggtgaaccca
gagtccatctttgatgtccaggtaaagaggatccatgagtacaagaggcagctgctcaac
tgtctgcacgccatcacgctctacaacagaatcaaactgcggccagagagagcgtttgtt
ccccggactgttatgattggaggaaaggcagcacctgggtaccacatggccaagatgatc
attaagctgatcacctcagtgggtgaggtggtcaataatgacccggcagtgggagacaag
ctgaaagtgatcttcttggagaactacagagtgtctttggcagagcaagtgatcccggca
gcggacctgtctgagcagatctcaactgcaggaacagaagcgtctggaacaggaaacatg
aagttcatgctgaacggcgctctgaccatcggcactatggacggtgccactgtggagatg
gctgaagaagcgggtgaagaaaatctcttcatctttggcttgaaggtggcggaagtggat
gaactggaccggaaaggctataatgctaaggagtactatgattctctgcctgaactgaaa
ctggctgtggaccagatccagaggggttacttcagtccctcagaaccagaacttttcaga
gaggtcactgagatgttgatgaagcacgacaggtttaaggtttttgcagattacgaagct
tacgtaaaacgtcaagaacaagtcagcgagctgtacgagaaccccagagaatggaccaaa
gtagtgattcggaacatcgcagctgcagggaagttctccagcgacagaactatctcccag
tacgcccgcgagatctggggcgttgaaccatctaacataaaattaccgtcccccaatgag
ccgttaatgaagtcccaaagctga

KEGG   Oryzias latipes (Japanese medaka): 101171113Help
Entry
101171113         CDS       T02443                                 

Definition
(RefSeq) glycogen phosphorylase, muscle form
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00500  Starch and sucrose metabolism
ola01100  Metabolic pathways
ola04217  Necroptosis
ola04910  Insulin signaling pathway
Module
ola_M00855  Glycogen degradation, glycogen => glucose-6P
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101171113
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101171113
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101171113
Enzymes [BR:ola01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     101171113
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphorylase TPR_22
Motif
Other DBs
NCBI-GeneID: 101171113
NCBI-ProteinID: XP_004080113
UniProt: H2M8T7
LinkDB All DBs
Position
18
AA seq 842 aa AA seqDB search
MAKPLSDQERRKQISVRGLAGVENVADLKTNFNRHLHFTLVKDRNVATKRDYYFALANTV
RDHLVGRWIRTQQHYYEKDPKRVYYLSLEFYMGRTLQNTMVNLGLESACDEAIYQLGLDM
EELQDIEEDAGLGNGGLGRLAACFLDSMASLGLAAYGYGIRYEFGIFNQKVVNGWQVEEA
DDWLRYGNPWEKARPEYMRPVHFYGRVQHTAEGVKWVDTQVVLALPYDTPVPGYRNNIVN
TMRLWSAKAPCDFNLKDFNVGGYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFV
VAATLQDIIRRFKASKFGSTEFVRIDLSTLPDKVAIQLNDTHPALAIPELMRILVDVEKL
SWEKAWDIVIRTCAYTNHTVLPEALERWPVDLFQNLLPRHLEIIYEINRRHMERITQLYP
GDVDRMRRMSLIEEGDVKKINMAHLCIVGSHAVNGVARIHSDIIKSTVFKDFYEMDPHKF
QNKTNGITPRRWLVMCNPGLADVIAERIGEDYIRDLDQLKKLLDFVDDEALIRDVAKVKQ
ENKLKFAAHLEEHYKVKINSDSMFDIHVKRIHEYKRQLLNCLHIITLYNRIKKEPNKKWT
PRTIMIGGKAAPGYHTAKMIIKLITSIGDVVNNDPVVGDRLKVIFLENYRVTLAEKVIPA
ADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRVDDVE
ALDKKGYDAMSYYNRIPELKQAVDQISGGFFSPDHPGLFKDLVNMLMHHDRFKVFADYED
YIQCQDKVSALYKDTKAWTKKVIHNIAGCGKFSSDRTISQYAREIWGMEPNLEKIAAPDD
PR
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaccgctgagcgaccaggagcgccggaagcagatctccgtgcggggactggcc
ggggtggagaatgtcgccgacctgaaaaccaatttcaaccgacaccttcatttcaccctg
gtgaaggaccggaacgtagcgaccaaacgggactattacttcgccctggccaacacggtc
cgggaccacctggtgggccgctggatccggacgcagcagcactactacgagaaggacccg
aagcgggtctactacctctccctggagttctacatgggacgcactctgcagaacaccatg
gtgaacctgggcctggagagcgcctgtgatgaggccatctaccagttggggctggacatg
gaggagctgcaggacattgaggaagatgcagggctggggaacggaggactgggccgcctt
gctgcctgtttcctggactccatggcctctctgggtctggccgcctacggttacggcatt
cgctacgagtttggcattttcaatcagaaggtggtcaacggctggcaggtggaagaggct
gatgattggctgcgctacggtaacccgtgggagaaggcgcgccccgagtacatgcggccc
gtccacttctatggccgggtccagcacacggccgaaggagtcaaatgggtcgacacgcag
gtggttctggctcttccgtatgacacccctgttcctggataccgaaacaacatcgtgaac
accatgaggctgtggtctgccaaggccccctgtgacttcaacctcaaagactttaacgtt
ggaggctacatccaagctgtgctggacaggaacctggcggagaacatctccagagttctg
taccccaacgacaacttctttgaggggaaggagctgcggctgaagcaggagtactttgtc
gtggcagcaactcttcaagacatcattcgccggttcaaagcctccaagttcggctccaca
gagtttgtgaggatcgatctctctactctgccagacaaggtggccatccagctaaacgac
acccaccctgctctggccattcctgagctgatgaggatcctggtggacgtggagaagctc
tcatgggagaaggcttgggacatcgtgatccgtacgtgtgcctacaccaaccacaccgtc
ctgccggaggcgctggagcgctggcccgtcgacctgtttcagaacctgctgcccagacac
ctggagatcatctatgagatcaacaggaggcacatggagcgcatcactcagctctacccc
ggagacgttgaccgcatgcgcagaatgtccctgatcgaggaaggggacgtcaagaaaatc
aacatggcccacctgtgcatcgtggggtctcacgccgtcaacggggtggcccgcatccac
tctgacatcatcaaaagcaccgtattcaaggatttctatgaaatggatccgcacaagttc
cagaacaagaccaacgggatcaccccccggcgctggctggtcatgtgtaacccggggctc
gccgacgtcatcgctgagaggatcggagaggattacatccgggacctggaccaactgaag
aagctgctggactttgtagacgacgaggcgctcatccgagatgtcgctaaagtcaaacag
gagaacaagctgaagtttgccgcccacctggaggaacactacaaggtgaagatcaacagt
gactccatgtttgacatccatgtgaagaggatccacgaatacaaacggcagctgctcaac
tgcctgcacatcatcactctgtacaaccgcatcaagaaggagcccaacaagaaatggacc
ccaaggaccatcatgattggagggaaagcagctccaggctaccacacggccaagatgatc
atcaaactcatcacatccatcggtgacgtggtcaacaacgatccggtcgtgggagaccgg
ctgaaggtcattttcctggagaactaccgagtgactctggctgaaaaggtcatccctgcg
gccgacctgtcggagcagatctccactgcagggaccgaggcctccggcaccggaaacatg
aaattcatgctgaacggcgctctgaccattggcaccatggatggagccaatgtggagatg
gcagaggaggctggagaggaaaacctcttcatcttcggcatgagggtggatgacgtggag
gctctggacaagaaaggttatgacgccatgtcgtactacaaccggatcccagagctgaag
caggcggtggaccagatctcaggaggcttcttcagtccagaccatccgggcctttttaaa
gacctggtcaacatgctgatgcaccatgacaggtttaaggtgtttgcagactatgaagat
tacatccagtgtcaggataaggtcagcgctctctacaaggacaccaaagcctggaccaag
aaggtcatccacaacatcgccggctgtggcaaattttccagcgaccgcaccatctcccag
tacgcccgggagatttggggcatggagccaaatttggagaagattgctgccccggacgac
cctcgctaa

DBGET integrated database retrieval system