KEGG   Oryzias latipes (Japanese medaka): 101158654
Entry
101158654         CDS       T02443                                 

Gene name
apaf1
Definition
(RefSeq) apoptotic protease-activating factor 1
  KO
K02084  apoptotic protease-activating factor
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
ola04210  Apoptosis
ola05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ola00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101158654 (apaf1)
   04115 p53 signaling pathway
    101158654 (apaf1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101158654 (apaf1)
SSDB
Motif
Pfam: WD40 APAF1_C NB-ARC ANAPC4_WD40 CARD eIF2A CARD_2 AAA_22 Utp8 AAA_16
Other DBs
NCBI-GeneID: 101158654
NCBI-ProteinID: XP_011489474
LinkDB
Position
23
AA seq 1252 aa
MALDERARACLLKSRHKLEEIMKPAYLMDHMISDEAITVEEEDMIANQNTKREQAAALVD
LLLKKDNYSFRSFYNALLKEEYDELANLLKEDLPLTQFTSSSQCPVQTVLSEGGVPPRPE
AFVHRPKEENEIREKLYKLQKQPGWVTVFGMAGSGKSVLASEAVRHKELIEECFPEGIHW
VSIGRLDKPDLLAKIQTLCFRLEQNLDSQQFHRPPSTLDEAKERLRFLMIRKYTRTLLIL
DDVWDSTVLKAVDIHCRILLTTRNRSLADVVNGSKHEVEVNSGLDEDKALEILSQLSKIE
MYRLPEEALSIVKKCQGSPLAVSMIGSLLRENPDRWGYYLRQLEKKQFRRIRKSSSYNYE
ALDQAIAAGIEDLSDDYRDLYNLLTVLHKDVKVTAKMMSVLWGQDQVDTEDTLSEFVNRA
MLFVDSQSQPNVFYLHDLQLDFLLEQNKNQLKSLHKKMVERYQHRYKDRPLTSRDEESLY
WIRYLAYHMANANLFQELHSLLFSLDWISVKGQIMGPAHLINDYLEYGSILDKENNEMCS
EFQEFLSLSGHYLEQRPFPDIVQLALSQPHTSEVYRQARLLAQERAKDGKLYFDLINETS
VDSLSRLVIHPHQGSLYACFSNDGTKIASCGATKNLKVFKSTSGEKLSEFELRDEVVCCA
FSPDDSLLAVCSSGRTIQVWNVHQVKLLRTFQEEHKEQINHCVFTNTTRRLLLATCSNDQ
MGNAKLWNLNKPTCQNTIFGHFEPVNHCCFSPDDNYVSTSSNDGTVKLFEATSGNIWKSI
DVRGMFKDPDNDDEVAVRCSSWTADGKRILCAARNAALMFDVETSDLLLEIRPSFLSTVL
HCDVCPTSNLLAMALSNYAVELWDIEENAKKADCSGHLSWVERVQFSRDGSQMLSCSDDE
TIRLWETKKLHMTSAVFLKRNTDVLFNDDNIFVSAPDHCNRLQVRDGRTGDTLLQSEKKP
SRIRCTCLLRDLSVVALGQEDGTVQVLAVPSAKPLATLLGHTKTVLHCQFTHYGQTLITS
SEDCTIRVWNLPSGECKVLQGHKEQVRCFALLSPSSNDSRLLSWSFDGTVKVWNTESGQK
LQDIDAHGGAILSCHVSPDGRLFATSSADRTAKLWHCEAWQCTFTLTGHQECVRSCRFSW
DSECLATGDDNGEIRLWNVNDGSLLRICSREVKDSMDSFHGGWVTDLHFSPDNSLLVSAG
GYIKWWDVKDGVALQTFYPKGNTLRKIHVSSDFSTFVTVDSIGILYVLQRVP
NT seq 3759 nt   +upstreamnt  +downstreamnt
atggccctggatgagagagcacgggcttgtctgctgaagtcccgccacaaactggaggag
atcatgaagccggcctacctgatggaccacatgatcagtgatgaagccatcacagtcgag
gaagaggacatgatcgctaatcagaacaccaagagggaacaagccgcagctttggttgac
ctcctgctgaaaaaagacaattacagcttcagatctttctacaacgctctgcttaaagaa
gaatatgacgagttggccaatctgctgaaagaggatctaccgctgacccagtttaccagc
agctctcagtgtcctgtccagactgtgctgagtgaaggaggcgtacccccaagaccagag
gcctttgtccacaggccaaaagaggagaatgaaatcagggagaagctctacaaacttcag
aagcaacctggttgggttacagtctttggcatggctggttcgggaaagtctgtacttgct
tctgaggctgtcagacacaaagaactcatcgaagagtgtttccctgaaggcatccactgg
gtgtccattggccgattggataaacctgacctgctggctaagatccagactttgtgtttt
cgtttggaacagaacctggattcacagcagttccaccggccccccagcactctggatgag
gccaaggaacgtttgcgcttcctcatgatccgaaaatataccaggactctgctgattctt
gacgacgtctgggacagcacggtgctgaaggccgttgatatccactgtcggattcttctg
accaccagaaaccggtcccttgctgatgttgttaatggtagtaaacacgaggtggaggtg
aactctggcttggatgaggacaaagcgctggagattctttctcagctgtccaaaattgag
atgtataggcttcctgaggaagctctaagcatcgtcaaaaaatgccaaggctctcctctg
gcggtgtccatgatcggctctctgctcagggagaatcctgaccgttggggttattacctc
agacagctagagaaaaaacagttccggcgtatcaggaagtcaagttcctataactacgag
gctttggatcaggctattgctgcaggcattgaagacttgtctgatgactacagagatctc
tacaacctcctgactgttctacacaaggacgtcaaagtcactgccaagatgatgtctgtt
ttatggggtcaggatcaagtggacactgaggacaccctctcagaatttgtcaacagagcc
atgctttttgtggactctcagtcccaacccaacgttttctacctccatgaccttcagctg
gattttttattggagcagaataaaaaccagttaaagagccttcacaaaaagatggtggaa
cgttaccagcaccgctacaaagacaggcctctgacctcaagagatgaggagtctctttac
tggatccgatacttggcttaccatatggccaatgctaaccttttccaggagctgcactcc
ctcttgttctccctggactggatcagcgtgaaggggcagataatgggtccggcccacctg
attaatgactatctggagtatggatccattctggacaaagagaacaatgaaatgtgcagt
gagttccaggagtttctgtccctgagtggccactacctggagcagcgtcctttccccgac
atcgtccagctcgctctctctcagccccacacctcagaggtttacagacaagctcggctg
ctggcacaggagagggccaaagacgggaagctctactttgacctcataaacgagaccagc
gtagacagtctgtcccgcttggtgattcatcctcatcaaggctctctgtatgcttgtttc
tcaaacgatggaacaaaaatcgcctcgtgtggagctactaagaacctcaaggtttttaaa
tcgacttcaggagagaaactttcagagtttgagctccgtgatgaagtggtctgctgtgcc
ttctcccctgatgacagcctgctggcagtctgctcaagtggaaggacaatccaggtgtgg
aacgtccatcaagtgaagttactgaggacctttcaggaggagcataaagagcagataaac
cactgtgtttttaccaacactacgcggcgcctcctgctggccacctgctccaacgaccaa
atgggaaacgccaagctgtggaatcttaacaagcctacctgtcaaaacacaatatttggc
cactttgaaccagtcaaccactgctgtttctcccctgatgataattatgtgtccacctcg
tccaatgatggtactgtgaagctgtttgaagccacatctgggaacatctggaagtcaatc
gatgtgagaggcatgtttaaagacccggataatgacgacgaggtggccgtcaggtgcagc
agctggacagctgatggcaaacgcatcctgtgtgctgccaggaacgctgctttgatgttt
gatgtggaaacgtcagacttgcttttggagatcaggcccagttttctcagcacggttcta
cattgtgacgtctgtcctactagtaacctgcttgctatggcactttctaactatgctgtg
gagctttgggatattgaagagaatgcaaagaaggcggattgcagcggtcatctcagttgg
gtggagcgtgtgcagttctcccgtgacggctctcagatgctctcctgctcggatgatgaa
actatcaggttgtgggagactaaaaagctccacatgacctcggcggtcttcctgaagaga
aacacagacgttttgttcaatgatgacaacattttcgtgtcggctccggaccactgcaac
agactgcaggttcgtgacggcagaactggagacacgttgctgcaatctgagaagaagccg
tccaggatccgctgtacctgtctgctcagggatctgtctgtggtggccctgggccaagag
gacgggactgtgcaggtgttggcagtgccctctgcgaagcctctagccaccctgttgggt
cacaccaagactgtgcttcactgccagttcacccactacggccaaacgctcatcacatca
tctgaggactgcaccataagggtgtggaatttgccgtcgggtgaatgtaaagtccttcag
ggtcacaaagagcaagtcagatgcttcgctctgctctccccatcttccaatgactccaga
ctgctgtcctggtcgttcgacggtaccgtcaaggtgtggaacacggaaagcggacagaag
ctgcaggacatcgacgctcacgggggagccatcctgtcctgtcatgtctcaccagacgga
agactgtttgctacctcctctgctgacaggaccgctaagttgtggcactgtgaggcctgg
cagtgtaccttcaccctgacggggcaccaggaatgcgtccgaagctgcagattctcgtgg
gacagcgaatgcctcgcgacaggagacgacaacggggagatccggctctggaatgtcaat
gacggttcgcttctgaggatttgttcccgagaagtgaaggacagcatggactccttccac
ggaggctgggtgactgatctgcacttctctccggacaactctcttctggtctcagctgga
ggctatatcaagtggtgggacgtgaaggacggggtcgccctgcagaccttctacccaaag
ggaaacactctgaggaagatccacgtgtcgtcagacttctccaccttcgtcaccgtcgac
agcatcggcatcctctacgtcctgcagagagtaccttga

DBGET integrated database retrieval system