KEGG   Oryzias latipes (Japanese medaka): 101158728
Entry
101158728         CDS       T02443                                 

Definition
(RefSeq) putative transcription factor p65 homolog
  KO
K04735  transcription factor p65
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04010  MAPK signaling pathway
ola04137  Mitophagy - animal
ola04210  Apoptosis
ola04218  Cellular senescence
ola04620  Toll-like receptor signaling pathway
ola04621  NOD-like receptor signaling pathway
ola04622  RIG-I-like receptor signaling pathway
ola04623  Cytosolic DNA-sensing pathway
ola04625  C-type lectin receptor signaling pathway
ola04920  Adipocytokine signaling pathway
ola05132  Salmonella infection
ola05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101158728
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    101158728
  09143 Cell growth and death
   04210 Apoptosis
    101158728
   04218 Cellular senescence
    101158728
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101158728
   04621 NOD-like receptor signaling pathway
    101158728
   04622 RIG-I-like receptor signaling pathway
    101158728
   04623 Cytosolic DNA-sensing pathway
    101158728
   04625 C-type lectin receptor signaling pathway
    101158728
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101158728
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101158728
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101158728
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ola03000]
    101158728
Transcription factors [BR:ola03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    101158728
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 101158728
NCBI-ProteinID: XP_004080070
UniProt: H2M641
LinkDB
Position
18
AA seq 617 aa
MDGVYGWGHPSINPVMPTNPYIEIIEQPKQRGMRFRYKCEGRSAGSIPGEKSNDTTKTYP
AIKVNNYNGPLRVRISLVTKNTPHKPHPHELVGKDCKHGYYEADLQERRIHSFQNLGIQC
VKKKDVNDAITCRLQTNNNPFNIPESKVWEEEFDLNSVRLCFQAKITLPTGELYPLEPVV
SQPIYDNRAPNTAELKICRINRNSGTCKGGDEIFLLCDKVQKEDIEVRFFQDSWEGKGTF
SQADVHRQVAIVFRTPPYRDTNLVEPVKVKMQLRRPSDREVSEPVDFQYLPADPDEYRLN
EKRKRTADVFQNLKLGSMLSSVSIPSDRRQMNFARRTVPPKLSSVNVSTGTETPPGASAA
KPQAPFLFTQPIQAPAPHKRELPDATSSQPWRFMETLKKDLQTPFAGSSSSAAPSSSTTI
SASTASNQYPTVNIADLQEFFPNILSPMNQEAEATQASSAPPQASSSFPLQASQFSTNPA
EDDLPEFPSFSEGQVPITLDSLNMDDFEDLLNVGGGGAVPIGSSGQQPHATAPPQNPTAG
QNPSDPAGNPGSTWMNYPNSIVNLLQSEGMMDAAPLNNHHSGYAEPDDYQLLSADDDRLM
SIYENENHAEFVAGRQT
NT seq 1854 nt   +upstreamnt  +downstreamnt
atggacggtgtgtacggatggggccacccctcaatcaacccagtcatgccgacgaacccc
tacatagagatcatcgagcagccgaagcaaagggggatgaggttccggtacaagtgcgag
ggccgctccgccgggagcattcctggagagaagagcaacgacaccaccaagacgtatcca
gccatcaaggtgaataattacaacggtccgctgagagttcgcatctccctggtgaccaaa
aacacaccgcacaagccccacccccatgaactggttggaaaagactgcaagcatggctac
tacgaggcagacctgcaggagaggagaatacacagttttcagaatctgggcatacagtgt
gtgaagaagaaggacgtgaatgacgccatcacctgcaggctgcagaccaacaacaaccct
ttcaacattcctgagtccaaggtgtgggaggaggagtttgacctgaattcggtgcggctt
tgcttccaggccaagatcacgctccccacaggggagctgtaccctctggagccggtcgtg
tcacagcccatctacgacaacagggcgccaaacacagccgagttaaagatctgcagaatc
aaccggaactctggaacctgcaaaggaggcgatgaaatctttctgctgtgtgacaaagtg
caaaaagaggacatcgaggtgcgtttcttccaggactcctgggaggggaagggcaccttc
tcccaggcggacgtgcacaggcaggtggcgatcgtcttccgcacgccgccctaccgtgac
accaaccttgttgagccagttaaggtgaagatgcagcttcggcggccgtctgaccgtgaa
gtgagcgagcctgtggacttccagtacctaccagctgacccagatgaataccggctgaat
gagaagagaaagcggacagcagatgtattccagaacttgaagctggggtcgatgctgtcc
agtgtttccatcccatcagaccggcggcaaatgaactttgcaaggagaacagtcccacct
aaactttcctctgtgaatgtgtcaaccgggaccgagacgccccctggtgccagtgcagcc
aaaccacaggcccctttcctcttcactcagccgatccaggcccctgcgccgcacaagagg
gagctccccgacgcaacttcaagccaaccctggagatttatggagactctgaagaaagat
ttacagacccccttcgcagggagttcttcatcagccgctccctcctcctccaccaccatc
agcgcctccacggcgagcaaccaataccccacagtcaacatagcagaccttcaggagttc
ttccccaacattttgtcccccatgaatcaggaggcagaagccactcaagctagtagtgcg
ccccctcaggccagcagctccttccccctccaggcctcgcagttctccacaaaccccgca
gaagacgacctcccagagttccccagcttctctgagggccaggtccccatcaccctggat
agcctgaacatggacgactttgaggaccttttgaacgtgggcgggggtggcgccgttccc
attggaagttcgggccagcagccccacgccaccgcacctccccagaatcccacagcgggc
cagaacccctcggaccctgctggcaacccaggaagcacctggatgaactaccccaacagc
atcgtcaacctgctgcagagcgagggcatgatggacgccgcccccctcaacaaccaccac
agcggctacgcagaacccgacgactaccagctgctgtccgccgacgacgaccgcctcatg
tccatttacgaaaatgaaaatcacgccgagtttgtggcgggacgccagacctaa

DBGET integrated database retrieval system