KEGG   Oryzias latipes (Japanese medaka): 101158845
Entry
101158845         CDS       T02443                                 

Definition
(RefSeq) protein shisa-5
  KO
K10135  scotin
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    101158845
SSDB
Motif
Pfam: Shisa
Other DBs
NCBI-GeneID: 101158845
NCBI-ProteinID: XP_004068714
LinkDB
Position
5
AA seq 257 aa
MALGPCSVFLLVFSVFLASHLSAGDDCLGYTDTHNKYQHPQDCYGTFCCGNCEYRYCCLN
LRKKFSEDDQNDCYLSPPDFPIPAMVAGIVGLIAFILIFVCCCVCPCCCLYKMCRKPQPV
IATTHHTVITSAPGQYPQQPTAVPAQSYQGVQPYPPYQSMAVQPGYGTHSMSPAVHQGPQ
FTPGPLPTYQEATANPAYPPQPMPYSQAAFYPGPGQLPYPLQPPVCSNATAPPPAHTDYL
AQPAYNPDYATPPPKTG
NT seq 774 nt   +upstreamnt  +downstreamnt
atggctttaggcccatgtagtgtgtttttgttggttttcagcgtgtttttagctagtcat
ctttcagctggggacgattgtctgggttacacggacacccataataaataccaacatccc
caagactgctatggcaccttttgctgtggaaactgtgaatacagatactgctgtctaaac
cttcgaaagaagttctctgaagatgatcagaacgactgttacctttctccacctgacttt
cctatccccgctatggtcgctggcattgtgggcctcatcgcattcatactcattttcgtc
tgctgctgtgtgtgcccgtgctgctgcctgtacaaaatgtgccgcaagccacagccggta
atcgctaccacccaccacactgtcatcacgagtgctcctgggcagtacccacagcaaccc
actgcagtgcccgcgcagtcctaccagggggtccagccttaccccccctaccagtctatg
gcggtgcagccgggctacggaactcactctatgtccccggcggttcatcaggggccgcag
ttcaccccgggaccgctgccaacctaccaggaagccactgccaaccctgcatacccgccc
cagccaatgccctacagccaggctgcattctaccctgggcctggacagctgccctaccct
ctgcagcctccagtctgttcaaatgctacggctccaccacctgcccacactgattaccta
gctcagcctgcatacaacccagactatgccaccccacctcccaaaactggttag

DBGET integrated database retrieval system