KEGG   Oryzias latipes (Japanese medaka): 101158860
Entry
101158860         CDS       T02443                                 

Gene name
rchy1
Definition
(RefSeq) RING finger and CHY zinc finger domain-containing protein 1
  KO
K10144  RING finger and CHY zinc finger domain-containing protein 1 [EC:2.3.2.27]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
ola04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ola00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101158860 (rchy1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    101158860 (rchy1)
Enzymes [BR:ola01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     101158860 (rchy1)
Ubiquitin system [BR:ola04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    101158860 (rchy1)
SSDB
Motif
Pfam: zinc_ribbon_6 zf-CHY zf-RING_2 Prok-RING_4 zf-C3HC4_2 zf-RING_4 zf-RING_UBOX zf-RING_5 HypA
Other DBs
NCBI-GeneID: 101158860
NCBI-ProteinID: XP_004072807
UniProt: A0A3B3I5G3 A0A3P9HSG1
LinkDB
Position
9
AA seq 261 aa
MASPVGCEHYVRGCLLKAPCCGKLYVCRLCHDAQENHPMDRFKVREVQCSKCNTLQQAQK
TCQQCQLQFGEYYCDICHLFDKDKKQYHCQPCGICRIGPSEKYFHCDKCNLCLAQDLRGN
HRCVENVSRQNCPVCMEDIHTSRIGAHVLPCGHLLHKTCFDDMVKTGVHRCPLCMRSAWN
LDYHWNLLDKEIAQTPMPSEYQDATVQVICHDCQTHCTVPFHVLGLKCTGCGSYNTAQDG
GLMWQQEGQNLQDEGEPEQQD
NT seq 786 nt   +upstreamnt  +downstreamnt
atggcttcacctgtcggttgtgaacattacgtacgcggttgtttgttaaaagcgccgtgc
tgtgggaaactgtacgtgtgtcgtctgtgccatgatgctcaggagaaccacccgatggat
cgcttcaaagtcagagaggtgcagtgctccaagtgtaacaccttgcagcaggcccaaaaa
acatgtcagcagtgtcagttacagtttggggaatattactgtgacatctgccatttgttt
gacaaggataagaagcagtaccactgccagccctgtggaatatgcaggattggacccagt
gagaagtacttccattgtgacaagtgcaatttgtgtctggcccaggatctgagaggaaac
cacagatgtgtcgaaaatgtctctaggcagaactgtccggtttgtatggaggatattcac
acgtccaggatcggtgctcatgtccttccatgtggccatcttttacacaagacttgcttc
gatgacatggtcaaaacaggcgtccaccgctgccccctgtgcatgcggtctgcttggaac
ctggactaccactggaacttgcttgacaaagagattgctcagacaccgatgccctctgag
taccaggatgccacagtccaagtgatatgtcatgattgccaaacccactgcacggtccct
ttccatgtgttggggctgaagtgcacaggctgtggctcctacaacaccgcacaggacgga
gggctaatgtggcagcaggaagggcaaaacctccaggatgaaggagaaccagagcagcag
gactag

DBGET integrated database retrieval system