KEGG   Oryzias latipes (Japanese medaka): 101158912
Entry
101158912         CDS       T02443                                 

Definition
(RefSeq) ribonucleoside-diphosphate reductase subunit M2
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00230  Purine metabolism
ola00240  Pyrimidine metabolism
ola00480  Glutathione metabolism
ola00983  Drug metabolism - other enzymes
ola01100  Metabolic pathways
ola04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101158912
   00240 Pyrimidine metabolism
    101158912
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    101158912
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    101158912
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    101158912
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ola03400]
    101158912
Enzymes [BR:ola01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     101158912
DNA repair and recombination proteins [BR:ola03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    101158912
SSDB
Motif
Pfam: Ribonuc_red_sm
Other DBs
NCBI-GeneID: 101158912
NCBI-ProteinID: XP_023808655
LinkDB
Position
24
AA seq 338 aa
MRRPGSACENTKSLKTEEEPQLKENPRRFVIFPVQYHDIWQMYKKAEASFWTAEEVDLSK
DLQHWETLKDDERFFISHVLAFFAASDGIVNENLVERFTQEVQVTEARCFYGFQIAMENI
HSEMYSLLIDTYIKDPKEREYLFNAIETLPCVKRKADWALNWIGNKHAAYGERVVAFAAV
EGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVNKPSSETVTE
IIRNAVEIEQEFLTEALPVKLIGMNCELMKQYIEFVADRLLLELGFSKIYRAENPFDFME
NISLEGKTNFFEKRVGEYQRMGVMAGPTDNTFRLDADF
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgaggaggcctgggagcgcatgtgagaacactaaaagccttaaaacggaggaggagccg
cagctgaaggagaatcctcgccgcttcgtcatcttccccgtccagtaccacgacatttgg
caaatgtacaagaaggctgaggcgtctttctggacggcagaggaggtggatctgtctaaa
gatctgcagcactgggagactttaaaggacgatgaacgcttcttcatctcccatgtgctg
gccttctttgcagccagtgatggaatagttaacgagaacctggtggagcggttcacacag
gaagttcaggtgacggaggccaggtgtttttatggtttccagatagccatggagaatatt
cattcagagatgtacagcctcctgatcgacacctacatcaaggatccaaaggagagagaa
tacctgtttaacgccatcgagactctgccgtgtgtgaagaggaaggcggactgggccctg
aactggattggaaacaagcacgccgcctatggggagagggtggtggcctttgcagcggtg
gaggggatcttcttctctggttcctttgctgccatcttctggctgaagaagaggggcctg
atgcccggcctgaccttcagtaacgagctcatcagcagagacgagggactccactgcgac
tttgcctgcctgatgttcaaacacctggtgaacaagccctcctcagaaaccgtcacagag
atcatcaggaacgctgtggagatcgagcaggagttcctgaccgaggctctgcccgtcaag
ctgatcgggatgaactgcgagctgatgaagcagtacatcgaatttgtagccgacaggctg
ctgctggagctgggcttctccaagatctacagagcagagaacccctttgacttcatggag
aacatctctctggaaggaaagaccaacttctttgagaagagagtaggagagtaccagagg
atgggggtcatggcgggccccacagacaacaccttcaggctggatgctgacttctga

KEGG   Oryzias latipes (Japanese medaka): 101164326
Entry
101164326         CDS       T02443                                 

Definition
(RefSeq) ribonucleoside-diphosphate reductase subunit M2 B
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00230  Purine metabolism
ola00240  Pyrimidine metabolism
ola00480  Glutathione metabolism
ola00983  Drug metabolism - other enzymes
ola01100  Metabolic pathways
ola04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101164326
   00240 Pyrimidine metabolism
    101164326
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    101164326
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    101164326
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    101164326
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ola03400]
    101164326
Enzymes [BR:ola01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     101164326
DNA repair and recombination proteins [BR:ola03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    101164326
SSDB
Motif
Pfam: Ribonuc_red_sm
Other DBs
NCBI-GeneID: 101164326
NCBI-ProteinID: XP_023815956
LinkDB
Position
11
AA seq 354 aa
MTPTVKKSSQDAHHISNGLKENDTGCPNGSETEDEPLLRENPRRFVIFPIQYPDIWKMYK
QAQASFWTVEEVDLSKDLVHWDRLKPDEKHFISNVLAFFAASDGIVNENLVQRFSLEVQV
PEARSFYSFQILIETVHSEMYSLLINTYIRDLKERDYLFNAIQTMPCVKRKADWALEWIN
DNKSTFGERLVAFAAVEGIFFSGSFAAIYWLKKRGLLPGLTYSNELISRDEGLHCNFACL
LYSYLVKKPSEDRVRGIITKAVCIEQEFLTEALPVDLIGMNCCLMKQYIEFVADRLLADL
DLDKVYKVENPFDFMESISLEGKTNFFEKRVAEYQRFGVMSNMLDGEFTLDADF
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgacgccaaccgttaagaaatcctcacaagatgcacatcatatcagtaacggtttgaaa
gaaaacgataccggctgcccgaatgggtcggaaaccgaggacgaacctttgctcagagaa
aaccccagacggtttgtcatcttccccatccagtacccagatatctggaaaatgtacaaa
caggcccaggcttccttctggacggtggaagaggttgatttatccaaagacttagtgcac
tgggatcgcttaaagcctgatgaaaaacactttatctccaatgttttagccttctttgct
gcaagcgatggcatagtcaacgagaacctggtgcagcggtttagcctggaggttcaggtc
cctgaagcacgttccttctacagcttccagatcctcatcgagaccgttcactcagagatg
tacagtttgctcatcaacacttacatcagggacctgaaggagagggactatttgttcaat
gccattcagaccatgccctgcgtgaaaagaaaagctgactgggcgctcgaatggattaac
gacaacaaatcaacattcggagagcgactggtggcttttgcggctgtggagggcatcttc
ttctctgggtcatttgctgccatctactggctcaagaagagaggactcctgcccggtcta
acctactccaatgagctgatcagcagggatgagggtttgcactgtaactttgcctgcctg
ctgtacagctacctggtgaaaaagccgtcagaggaccgggtcagggggatcataactaag
gccgtctgcatcgaacaggagtttctcacggaggccttgccggtcgatctcattggaatg
aactgctgcctcatgaagcagtacattgagtttgtggctgaccggctgctcgccgatctt
gacctggacaaggtttacaaagtggaaaacccatttgactttatggagtcaatctcgctt
gaagggaaaaccaacttctttgagaaaagagtagcagaatatcagagatttggggtgatg
tcgaatatgttggacggggaattcactcttgatgcagacttttaa

KEGG   Oryzias latipes (Japanese medaka): 101166844
Entry
101166844         CDS       T02443                                 

Definition
(RefSeq) ribonucleoside-diphosphate reductase subunit M2-like
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00230  Purine metabolism
ola00240  Pyrimidine metabolism
ola00480  Glutathione metabolism
ola00983  Drug metabolism - other enzymes
ola01100  Metabolic pathways
ola04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101166844
   00240 Pyrimidine metabolism
    101166844
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    101166844
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    101166844
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    101166844
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ola03400]
    101166844
Enzymes [BR:ola01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     101166844
DNA repair and recombination proteins [BR:ola03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    101166844
SSDB
Motif
Pfam: Ribonuc_red_sm
Other DBs
NCBI-GeneID: 101166844
NCBI-ProteinID: XP_023808654
LinkDB
Position
24
AA seq 379 aa
MLSARSPLSMKTENSVNVKMSSMALDKENTPPSLNSSRVLGSKTARKIFSDAKSLKTEEE
PLLKENPRRFVIFPVQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWETLKDDERFFISHV
LAFFAASDGIVNENLVERFTQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKER
EYLFNAIETLPCVKRKADWALNWIGNKHAAYGERVVAFAAVEGIFFSGSFAAIFWLKKRG
LMPGLTFSNELISRDEGLHCDFACLMFKHLVNKPSSETVTEIIRNAVEIEQEFLTEALPV
KLIGMNCELMKQYIEFVADRLLLELGFSKIYRAENPFDFMENISLEGKTNFFEKRVGEYQ
RMGVMAGPTDNTFRLDADF
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgttgtccgcgcggtcccccctctcaatgaagactgaaaacagcgttaacgttaagatg
agcagcatggcgctcgacaaagaaaacacgccgcccagtctgaacagcagccgcgtcctc
gggtccaaaacggcgcggaagattttcagcgacgccaaaagccttaaaacggaggaggag
ccgctgctgaaggagaatcctcgccgcttcgtcatcttccccgtccagtaccacgacatt
tggcaaatgtacaagaaggctgaggcgtctttctggacggcagaggaggtggatctgtct
aaagatctgcagcactgggagactttaaaggacgatgaacgcttcttcatctcccatgtg
ctggccttctttgcagccagtgatggaatagttaacgagaacctggtggagcggttcaca
caggaagttcaggtgacggaggccaggtgtttttatggtttccagatagccatggagaat
attcattcagagatgtacagcctcctgatcgacacctacatcaaggatccaaaggagaga
gaatacctgtttaacgccatcgagactctgccgtgtgtgaagaggaaggcggactgggcc
ctgaactggattggaaacaagcacgccgcctatggggagagggtggtggcctttgcagcg
gtggaggggatcttcttctctggttcctttgctgccatcttctggctgaagaagaggggc
ctgatgcccggcctgaccttcagtaacgagctcatcagcagagacgagggactccactgc
gactttgcctgcctgatgttcaaacacctggtgaacaagccctcctcagaaaccgtcaca
gagatcatcaggaacgctgtggagatcgagcaggagttcctgaccgaggctctgcccgtc
aagctgatcgggatgaactgcgagctgatgaagcagtacatcgaatttgtagccgacagg
ctgctgctggagctgggcttctccaagatctacagagcagagaacccctttgacttcatg
gagaacatctctctggaaggaaagaccaacttctttgagaagagagtaggagagtaccag
aggatgggggtcatggcgggccccacagacaacaccttcaggctggatgctgacttctga

DBGET integrated database retrieval system