KEGG   Oryzias latipes (Japanese medaka): 101159186
Entry
101159186         CDS       T02443                                 

Gene name
mdm4
Definition
(RefSeq) protein Mdm4 isoform X2
  KO
K10127  protein Mdm4
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    101159186 (mdm4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ola04121]
    101159186 (mdm4)
Ubiquitin system [BR:ola04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    101159186 (mdm4)
SSDB
Motif
Pfam: SWIB zf-C3HC4_3 zf-RanBP
Other DBs
NCBI-GeneID: 101159186
NCBI-ProteinID: XP_004069200
UniProt: A0A3B3HVM2
LinkDB
Position
5
AA seq 491 aa
MNASSSQPSASSSSCRTLPGDGNQVQPKPPLLQILRVAGAQEDVFTLKEVMHYLGQYIMG
KQLYDKQRQHIVHCQDDPLGELLEVDSFSVKNPSPVYEMLKKNLVVLDCSDAAENLSVGR
ECIEGGVEDRGQVCGGGVIPTGAMASSDVPLLLTPCQRRPREPDDESLEGLPRSACKRPK
LDVTLDDWDLSGLPWWFLGNLRNNYSRRSNGSTDIHTNQEEDTAIVSDTTEDLWFLTEGG
SEQVSVEMKEAVVEEGSGGEGEGSFEEDCGGTKEETADREMQEEQDEDLQCLSDDTDTEL
STQDAWQCTECKKYNTPLQRYCVRCWALRKNWFKDVPRLAHSLSVPDIPACSSLAAQDDD
DSDAGIDVPDCTRTVSDPVILPSHSKADRPLPPMGINKGKGPHSLGSHKEEQLSEGESQE
SLGMEFEDVRPEALLEPCKLCRVRPRNGNIIHGGTAHLLTCFPCARRLHKFQAPCPGCGK
IIQKVIKIFIL
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgaacgcctcctcatcccagccttcagcttcaagctcttcatgcagaacactacctgga
gatgggaatcaggttcaaccaaaacctcctctcctccagattctgcgagtcgctggagct
caagaagatgtcttcacacttaaggaggtgatgcactacctgggtcagtacatcatggga
aagcagctatatgacaaacagaggcagcacattgtccactgccaagatgaccctctggga
gaactgctggaagttgacagcttctctgttaaaaatccaagcccagtgtatgaaatgctg
aagaagaacttggttgtgcttgattgcagtgacgctgcagagaatctttctgtgggccga
gaatgtatagagggcggagtggaggatcgtggtcaggtttgcggaggaggtgtgatccca
acaggagcgatggccagcagtgatgtgcctctcctgctgacaccctgccagagacgaccc
cgcgagcctgatgatgaatctcttgaaggcctgccacgctcagcctgcaaacggcccaaa
ctggatgttactctggacgattgggatctttccggccttccctggtggtttctgggtaat
ctccgcaacaactacagccgcaggagcaatggttccactgatatccacacaaaccaggag
gaggacacagccattgtgtccgacacgaccgaagacctctggttcctaacggaaggcggg
agtgaacaagtgagtgtggagatgaaagaagctgtcgtggaagaagggagcggtggagaa
ggagaaggttcctttgaggaagactgtggaggaacaaaggaggaaacggctgaccgagag
atgcaggaggagcaggacgaagacttgcagtgtctgagcgatgacacggacacggagctc
tccacacaggatgcgtggcagtgtacagagtgcaaaaagtacaacacacctcttcagaga
tactgcgtccgctgctgggctctgcggaaaaactggtttaaagatgtccctcgcctcgca
cattccctgtctgtccctgacatcccggcgtgcagttctctcgccgcccaagatgacgat
gacagcgacgcaggcatcgacgttccagactgcaccaggaccgtgtccgacccagtcatc
ttgccctcccactctaaagctgaccgaccattgccccccatgggcataaacaaaggcaaa
ggaccacattctttgggctctcacaaggaggagcagctctcagaaggggaaagtcaggaa
agtctaggtatggagtttgaagacgttcgaccagaggcgctcttggagccctgcaagctg
tgtcgagtccgaccgcggaacgggaatattattcacggaggcaccgcccacttgctgacc
tgttttccgtgtgcacggaggcttcacaagttccaggctccatgtccaggatgtggaaag
ataattcaaaaagttattaagatatttatcctttaa

DBGET integrated database retrieval system