KEGG   Oryzias latipes (Japanese medaka): 101159210
Entry
101159210         CDS       T02443                                 

Gene name
ccng2
Definition
(RefSeq) cyclin-G2
  KO
K10146  cyclin G2
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04068  FoxO signaling pathway
ola04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101159210 (ccng2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    101159210 (ccng2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 101159210
NCBI-ProteinID: XP_004075196
LinkDB
Position
12
AA seq 334 aa
MDAVKLMKELRVNYEQEASYLPKETGLSLIESTVQGDSRISAKCRDAKVEDLWSLTSFFD
YTTQTFVLAVNLLDRFLAMMRIQPKHLSCISLSCLHMAAKVTEEECNLTPTDELIRIGQC
RFTVSDLCRMEKIVAEKLNFKSKAVTALTFLHLYHQITASYCTDRKETLSLDKLEAQLKA
CLCRISFSKAKPSVLALSLLKQEVEAIQSEDMLEITHHIQRHLKIADSELLLWGERVARC
LSEYASPECSKPNHRKLQWIVSRRTAQNLHSHRTAPELPTIPEGCWDESESDDSCEDTMS
SGEESLSSSLGSDAEGPYFPLRLRRQKPQQYLHA
NT seq 1005 nt   +upstreamnt  +downstreamnt
atggacgccgtcaagctgatgaaagagctgagggtgaactatgagcaggaggcttcctat
cttccaaaagagaccggactgagtctcatcgaatccacggtgcagggggacagcaggatc
tccgccaagtgtagagacgccaaagtggaggatctctggagtctgacgagcttctttgac
tacaccacacagacctttgttctggctgttaacctgctggacagattcctggctatgatg
aggattcagccgaagcacctgtcctgcatcagcctcagctgccttcacatggccgccaag
gtgacggaggaagagtgcaacctgacgcccaccgacgagctcatccgcatcggccagtgc
aggttcacagtttccgacctgtgccggatggagaagatcgtggcggagaagctcaacttc
aagtccaaagccgtcaccgccttaacttttctgcacctgtaccaccagatcacagcttcc
tactgcaccgacaggaaggagactctgagcctggacaagctggaggctcaactcaaagcc
tgtctgtgcagaatctccttttccaaagcaaagccgtccgtcctggccctgtccctcctg
aagcaggaggtggaagccatccagtcagaggacatgctggagatcacccatcacatccag
agacacctgaagattgcagacagcgagctgctgctgtggggcgagcgggtggcccgctgc
ctgtcggagtacgcctcccccgagtgcagcaaacccaaccacaggaagctgcagtggatc
gtgtcgcggcggaccgcccagaacctgcacagccaccgcaccgcaccggagctgcccacc
attccagagggctgctgggacgagagcgagagcgacgactcctgtgaggacaccatgagc
tcaggggaggagtctctcagcagctctctgggcagcgacgccgagggcccctacttcccg
cttcgcctccggcgccaaaagccccagcagtacctccacgcctga

KEGG   Oryzias latipes (Japanese medaka): 101159996
Entry
101159996         CDS       T02443                                 

Definition
(RefSeq) cyclin-G2 isoform X2
  KO
K10146  cyclin G2
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04068  FoxO signaling pathway
ola04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101159996
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    101159996
SSDB
Motif
Pfam: Cyclin_N Cyclin_C MazG_C
Other DBs
NCBI-GeneID: 101159996
NCBI-ProteinID: XP_004072097
UniProt: H2L3Z2
LinkDB
Position
9
AA seq 331 aa
MRDLPGIDSLLLKKLKVCCAKEDSVLPRETGLKLMESTPAENSSGVSAKCRDSRVEELWG
LTTFFGYSTQTFVQAVNLLDRFLTLMKVQRKHVPCIGVCCLHMAAKMIEEEADVSPTHEL
IRISQSRFTVSDLSRMEKIISEKLCLDPKAVTALTFLQLYHSAIASQSAGREEIPSIGRL
EAQLKACLCRLVFSKAKPSVLALSLVAQEFESFSVMKTVQQFQKHLKISDAELLGWKELV
AECMSAYHSSQCSKPDNKKLVWIVSRRTAQGLQSCHFSVPALPTIPERSWNQSQSEDSGE
DTSCSEESPCGSLGSDGEGTFFPSSFHHSRD
NT seq 996 nt   +upstreamnt  +downstreamnt
atgagggatcttcctggcattgacagtttgctcttaaaaaagctgaaggtatgttgtgcc
aaagaggacagcgttctccccagagagacgggcctgaagctgatggagtccactcctgca
gagaactccagtggggtgtctgcaaagtgccgggacagccgggtggaggaactgtggggc
ctgaccactttctttggctacagcacccaaacctttgtccaagctgtcaatttgcttgac
agatttctcaccttgatgaaggtgcagcgcaaacacgtcccctgcatcggagtctgctgt
cttcacatggccgccaaaatgattgaggaggaggccgacgtctcgccgacccacgaactc
atccgcatcagccaaagcaggttcacggtgtcggacctcagccgcatggagaagatcatc
tcggagaaactgtgcctggatcccaaagcggtgacggccttgaccttcctgcagctttac
cactccgccatcgcctcccagtctgccggcagggaggagatcccaagcattgggagactg
gaagcccagcttaaagcctgtttatgccggcttgttttctctaaagcaaaaccgtcggtg
ttggcgctgtcgctcgtcgctcaggagtttgagtcgttctcggtgatgaagactgtccaa
cagtttcaaaagcatctaaaaatcagcgacgctgagctgctcggatggaaggagctggtg
gccgagtgcatgagcgcctaccactccagccaatgcagcaaaccggacaacaaaaagctg
gtttggattgtgtccaggagaaccgcccagggccttcagagctgtcacttcagcgttccc
gctctgccgaccattcctgagaggagctggaaccagagccaaagcgaggactcgggcgag
gacacgagctgctctgaggaaagtccatgcggttccttaggaagcgacggcgaaggaacc
ttcttcccctccagcttccaccacagccgagactga

KEGG   Oryzias latipes (Japanese medaka): 101165649
Entry
101165649         CDS       T02443                                 

Gene name
ccng1
Definition
(RefSeq) cyclin-G1
  KO
K10145  cyclin G1
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    101165649 (ccng1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C DNA_photolyase
Other DBs
NCBI-GeneID: 101165649
NCBI-ProteinID: XP_004073384
LinkDB
Position
10
AA seq 299 aa
MIDTVTGAGVQSSAAQLKTLIDLEARYQPKLSGLRLIECAQDNGLRMTAKLRELEVKDLL
SLSRFFGFSAETFSLAVSLLDRFLSVMKIQPKHLSCVGLCCFYIAIKSSEEEKNVPLAND
LIRISQNRFTVSDMMRMEKIVMEKLYWKVKAPTTLHFLRLIHSHIQEQLDSEGKMILSIE
RLESQLKACHCSFAFSKIKPSLLAMALVCYEAQDQHDPEQIDQISEAVKSLQKLLNVRDG
DLVCVRELVRKCLAEYATTKCFKPHCLRLRWTISGRTARQLKHSYYKIAHLPTIPESAC
NT seq 900 nt   +upstreamnt  +downstreamnt
atgattgatacagtgacgggagctggagtgcagtcctctgcagctcagctgaagaccctg
atagatctggaggccagataccaaccaaagctgagcggattgaggctcattgagtgtgcc
caggacaatggcctaaggatgactgcaaaactcagagagctggaggtgaaagacctgctc
tctctttccaggttctttggttttagcgcagagaccttctccttggctgtgagcctgctg
gatcgatttctctctgtaatgaagattcagccaaagcacctctcctgtgttggtctttgc
tgcttctacatcgctataaagtcctcagaggaggagaaaaatgtgcctctggcaaatgac
ctcatccgcatcagtcagaatcgcttcactgtgtctgatatgatgaggatggagaagatc
gtcatggagaaattatactggaaggtgaaagcccccacaaccctccactttcttcgactg
attcacagtcatatccaggagcagcttgactctgagggcaaaatgatcttaagtatcgag
agactggagtcgcagcttaaagcctgtcattgctcatttgctttctccaaaataaagcct
tctttgcttgcaatggctctagtttgctatgaggcccaggatcaacatgaccctgaacag
atcgaccagatatctgaggctgtgaaaagtctgcagaagctgctaaatgtaagagatgga
gacctggtttgtgtgagggagcttgttagaaagtgtctggctgaatatgccaccaccaag
tgcttcaagcctcactgtctgagactccgctggaccatctcggggagaaccgctcgtcag
ctgaagcacagctactacaagatcgcccatcttcccaccataccagagtcagcttgttaa

DBGET integrated database retrieval system