KEGG   Oryzias latipes (Japanese medaka): 101159264
Entry
101159264         CDS       T02443                                 

Definition
(RefSeq) reprimo-like protein
  KO
K10128  reprimo, TP53-dependent G2 arrest mediator candidate
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    101159264
SSDB
Motif
Pfam: Tmemb_9
Other DBs
NCBI-GeneID: 101159264
NCBI-ProteinID: XP_011476228
UniProt: A0A3P9H1H5 H2LE50
LinkDB
Position
8
AA seq 111 aa
MNVSLFNMTQEALFNGSQTLTDALATYSSNSTDDVVTGDGGGSLVLLQEERKLFVMRVVQ
IAVLCVLSLTVMFGIFFLGCNLMIKSESMINFLVKERRPSKDVETVMVGLS
NT seq 336 nt   +upstreamnt  +downstreamnt
atgaatgtgtctctctttaacatgactcaggaagcgctctttaacgggagtcagaccctc
accgatgctctggcgacatactcaagtaacagcacggacgacgtggttactggagatggc
ggagggtcgctggtgcttctgcaggaagagcgtaaactcttcgtcatgcgtgtggtgcag
atcgctgttctgtgcgtcctgtcgctcaccgtcatgttcggcatatttttcctgggttgc
aacctgatgatcaaatcagagagcatgattaacttcttggtgaaagagcggagaccttca
aaagacgtggagactgtcatggttgggctcagctag

KEGG   Oryzias latipes (Japanese medaka): 101172617
Entry
101172617         CDS       T02443                                 

Gene name
rprm
Definition
(RefSeq) protein reprimo
  KO
K10128  reprimo, TP53-dependent G2 arrest mediator candidate
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    101172617 (rprm)
SSDB
Motif
Pfam: Tmemb_9
Other DBs
NCBI-GeneID: 101172617
NCBI-ProteinID: XP_004081765
UniProt: H2MQ42
LinkDB
Position
21
AA seq 103 aa
MNHTTLNQTESGLFSNKTGEFLCCNFSSVVTDNGFVAAAPDERSLFIMRVVQIAVMCVLS
LTVVFGIFFLGCNLLIKSEGMINFLVTDRRPSKEVDAVVVGAY
NT seq 312 nt   +upstreamnt  +downstreamnt
atgaatcacactacgctgaaccaaacagagagcgggctcttcagcaacaagacgggcgag
tttctctgctgtaacttttcctccgtggtgacggacaacggctttgtggccgccgctccg
gatgagaggagcctcttcatcatgagggtggtccagatcgccgtcatgtgcgtcctgtcc
ctcacagtggtgtttggcatctttttcttgggctgcaacctcctcatcaagtcagaaggg
atgatcaactttttggtaacggacaggagaccgtccaaagaggtggacgcagtagttgtg
ggagcctactga

DBGET integrated database retrieval system