KEGG   Oryzias latipes (Japanese medaka): 101159417
Entry
101159417         CDS       T02443                                 

Definition
(RefSeq) lysophosphatidic acid receptor 1-A-like
  KO
K04291  lysophosphatidic acid receptor 2
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04080  Neuroactive ligand-receptor interaction
ola04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101159417
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101159417
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ola04030]
    101159417
G protein-coupled receptors [BR:ola04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    101159417
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Other DBs
NCBI-GeneID: 101159417
NCBI-ProteinID: NP_001279993
UniProt: A0A024FS16
LinkDB
Position
1
AA seq 350 aa
MEVCAANRTVKFYYEHSGKNISDHWRKRDYVVVTLGLTVCIIVILSNLLVMGAIFKNRRF
HFPIYYLLANLALADFFSGISYLHLMFHTGPWTIKLSVQQWFVRQGLIDTSLTASVLNLL
AVAVERHQTIFKMQLHSEMSTRRIFVIIVFIWLVAIILGLIPSMGWHCLCDLEQCSTMAP
MYSRRYLVFWAILNLLTFTIMVVVYIRIFLYVRHKSKQMSQHTREVRHKETVVSLMKTVS
MILGFFVICWTPGLVVLLLDGLDCEKCNVLRYEKYCLVLAECNSFVNAIIYSFRDKDMRK
TFKEILCCMSNRSGNQGGTSEVYFNNTEHEVLSESNGVVGSRRKLNNHFH
NT seq 1053 nt   +upstreamnt  +downstreamnt
atggaggtgtgcgccgcaaaccgcaccgtcaaattttactatgaacatagtggcaagaac
attagtgaccactggcgcaaacgtgactatgtggttgttaccctgggcttgacggtttgc
atcattgttatcctttccaacctactggttatgggagccatctttaaaaaccgccgcttt
cattttcccatctactacctgctggcaaatctggctttggctgactttttttcaggtatc
tcatacctccacttgatgtttcacaccgggccctggaccattaagctgtccgttcagcag
tggtttgtgcggcaggggttgattgacaccagcctcacagcctcggtcctcaaccttctg
gcggtggctgtggagcgccaccaaaccatctttaaaatgcagctgcacagtgagatgagc
acccgtcggatttttgtcatcatcgtgttcatctggttagtggccatcatcctgggcctg
attccttcaatgggctggcactgcctgtgcgacttagaacagtgctctaccatggcgccg
atgtacagccgcagatacctagtgttctgggccattctcaacttgctgaccttcaccata
atggtggtggtctacatccggatctttctctatgtgaggcacaagagcaagcagatgtca
cagcacacaagggaagtccgtcacaaagagactgtggttagtctgatgaagaccgtctcc
atgatcttaggcttttttgtgatctgctggacacccgggctcgtggtgctgctgctggat
ggcctggactgcgagaagtgcaacgtgctccgctacgagaaatactgcctggttctagct
gagtgcaactccttcgtcaacgccatcatctactccttcagggacaaagacatgaggaaa
accttcaaggagatcctgtgctgcatgtccaatcgaagcggcaatcaaggcggcacctcc
gaggtttactttaacaacacagagcacgaggtactgtctgagagcaatggcgtagttggg
agcaggcggaagctaaacaaccacttccactaa

DBGET integrated database retrieval system