KEGG   Oryzias latipes (Japanese medaka): 101159499
Entry
101159499         CDS       T02443                                 

Gene name
ddb2
Definition
(RefSeq) DNA damage-binding protein 2
  KO
K10140  DNA damage-binding protein 2
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola03420  Nucleotide excision repair
ola04115  p53 signaling pathway
ola04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ola00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101159499 (ddb2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    101159499 (ddb2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    101159499 (ddb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ola04121]
    101159499 (ddb2)
   03400 DNA repair and recombination proteins [BR:ola03400]
    101159499 (ddb2)
Ubiquitin system [BR:ola04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     101159499 (ddb2)
DNA repair and recombination proteins [BR:ola03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      101159499 (ddb2)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 DotA
Other DBs
NCBI-GeneID: 101159499
NCBI-ProteinID: XP_020559679
LinkDB
Position
6
AA seq 488 aa
MKRRKNTKPGENGPKSQVKKRTEADSGASLSKKLKEKIEVKTSEPERPPVKPHTAQRRNG
HNSILHYIYRNSLGQSLHSQMRQCLQEPFVRSLSAYHFHGATSPFDRRITCLEWHPTHPT
TLAAASKGGDIFLWDFEKPTKKSFIQGNGAGDFIGGMKFCPTDSSRVYVATGEGKLTLQS
FEGHPPTLLSKTQDCDHNHHNLCVWFCCVDVSVSRQTLVTGDNMGELLLVSLNGQKIFSE
KLHKGKVTHAEFNPRCDWLLATASVDRTVKLWDLRNMKDRKSFLYEMPHERPVNSAYFNP
LDCTKLLTTDQQDQIRVYSSCDWSKPQQIIQHPHRQFQHLTPIKATWHPTYDLVVAGRYP
DDRICSGDQRTIDIYDSNTAELVYQLYDATALGIKSINKFSPMGDVIGSCMGVTVLVWDH
DNSLVSGQHNPKEESSAVDPRRQQRRSQQRSSRERKTPTLEPKLKKKLASLEETETKTKT
GCSKKKKT
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgaaaagaaggaagaacacgaaaccaggtgaaaatggaccaaagagtcaagtgaaaaaa
agaactgaagcagactctggagcatcactctccaaaaaattaaaggaaaagatagaagtg
aagacctctgagccagagcgtccacctgtcaagccccatacagctcagaggagaaatggc
cataacagcatcctgcactacatttacaggaacagtctaggccaaagtctgcattctcag
atgagacagtgtcttcaggagccctttgtccgctctctctccgcctatcatttccatggt
gctaccagccccttcgatcgcagaatcacctgtctggagtggcaccccacccatcccacc
acactagcagcagcctccaaaggtggagacatctttctctgggactttgaaaagcccaca
aagaaaagcttcatccaagggaatggagccggagacttcattggagggatgaagttctgc
cctacagactcctccagagtgtatgtggcaaccggtgaggggaaactgaccctgcagagc
tttgaaggccacccacctaccctgctgtccaaaacgcaagactgtgaccacaatcatcac
aatctttgcgtttggttttgctgtgttgacgtgtctgtgagccgacagacgctcgtcacg
ggggacaacatgggagagctgttactcgtcagtttgaacggccaaaagattttcagtgag
aagttgcacaaaggcaaggtgacccatgcagagtttaacccccgctgcgactggttgctg
gcgactgcttccgtcgatcggacggtgaagctttgggacttgaggaacatgaaggacaga
aagagtttcctgtacgagatgcctcatgaaaggcctgtcaactcagcttatttcaaccct
ttggactgcaccaagctgctcactacagaccaacaggaccagatccgagtgtactcatcc
tgtgattggtcaaagcctcagcaaatcatccagcacccacacagacagtttcagcacctc
acccccatcaaggccacatggcatcctacgtatgacctcgttgttgctggacgttaccct
gacgaccgcatctgctctggtgaccagaggaccattgacatctatgactccaacactgca
gagctggtttatcagctgtatgacgccactgctttaggaatcaagtctataaacaaattc
agcccaatgggtgacgtgattggatcttgtatgggtgtgacggtgctggtctgggaccac
gataattctctagtcagcggtcagcacaatccgaaggaggaatcctctgctgttgatccg
aggaggcagcagcggaggagccagcagcgctccagcagggaaaggaagacgccgactttg
gagccaaaacttaagaaaaaactagcttctctggaagaaactgagaccaagactaaaacc
ggatgttccaagaaaaagaaaacgtag

DBGET integrated database retrieval system