KEGG   Oryzias latipes (Japanese medaka): 101159503
Entry
101159503         CDS       T02443                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: bcl-2-like protein 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
ola04137  Mitophagy - animal
ola04140  Autophagy - animal
ola04210  Apoptosis
ola04621  NOD-like receptor signaling pathway
ola05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ola00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101159503
   04137 Mitophagy - animal
    101159503
  09143 Cell growth and death
   04210 Apoptosis
    101159503
   04115 p53 signaling pathway
    101159503
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101159503
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101159503
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ola01009]
    101159503
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ola03036]
    101159503
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ola02000]
    101159503
Protein phosphatases and associated proteins [BR:ola01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101159503
Chromosome and associated proteins [BR:ola03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    101159503
Transporters [BR:ola02000]
 Other transporters
  Pores ion channels [TC:1]
   101159503
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3 MA3
Other DBs
NCBI-GeneID: 101159503
NCBI-ProteinID: XP_023812146
LinkDB
Position
7
AA seq 253 aa
MSRNRELVVFYVKYKLSQRNYPLNHIVLNESPNRTAAGEVGEEQSTETHANGTFNGTTPG
TPPLSPLREQQLPSTTNMDAVKEALRDTANEFELRYALAFNNLHSQLHITPATAYQSFEN
VMNELFRDNINWGRIVGLFAFGGALCVECVEKEMSPLVDRIVEWMTVYLDNHIQPWIQSQ
GGWERFAEIFGQEAAAESRRSQESFKKWLLVGMTVATGVLVGSSSPRNACEGTGPPLQFH
VPAPICLLHYPQH
NT seq 762 nt   +upstreamnt  +downstreamnt
atgtcccggaacagagaactggttgttttctacgtgaagtataaactgtctcagaggaac
taccccctcaaccacatagtgctcaatgagtctccgaacaggactgctgcgggggaggtg
ggcgaggagcagagcacggagacgcacgccaacgggacgtttaacgggacaactcccggg
accccgccgctctccccgctgcgagagcaacagttgccgtcgacgacaaacatggacgca
gtgaaggaggcgctccgggacacggccaacgagttcgagctccggtacgcccttgccttc
aacaacctgcacagccagctgcacatcacgcccgccacggcctaccagagcttcgagaac
gtgatgaacgagctgttccgcgacaacatcaactggggccgcatcgtggggctcttcgca
ttcggcggggcgctgtgcgtggagtgcgttgagaaggagatgagccccctggtggaccgg
attgtggagtggatgaccgtctacctggacaaccacatccagccctggatccagagccaa
ggcggatgggagcgttttgctgaaatctttgggcaggaagccgcggctgagagcagaagg
tctcaggagagcttcaagaagtggctgctggtggggatgacggtggcgaccggcgtcctg
gtgggatcctcctcgcccagaaacgcctgtgaggggacggggcctcctctccagttccac
gtcccagctcccatctgcctcctccactaccctcaacattga

KEGG   Oryzias latipes (Japanese medaka): 101165300
Entry
101165300         CDS       T02443                                 

Definition
(RefSeq) bcl-2-like protein 1 isoform X1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
ola04137  Mitophagy - animal
ola04140  Autophagy - animal
ola04210  Apoptosis
ola04621  NOD-like receptor signaling pathway
ola05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ola00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101165300
   04137 Mitophagy - animal
    101165300
  09143 Cell growth and death
   04210 Apoptosis
    101165300
   04115 p53 signaling pathway
    101165300
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101165300
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101165300
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ola01009]
    101165300
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ola03036]
    101165300
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ola02000]
    101165300
Protein phosphatases and associated proteins [BR:ola01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101165300
Chromosome and associated proteins [BR:ola03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    101165300
Transporters [BR:ola02000]
 Other transporters
  Pores ion channels [TC:1]
   101165300
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3 Ald_deCOase
Other DBs
NCBI-GeneID: 101165300
NCBI-ProteinID: XP_011473713
UniProt: A0A3B3I2Q5
LinkDB
Position
5
AA seq 217 aa
MSHCNRELVRFYLAYKMSCRDYPVSLLKPTDDGGETEEDHSDARNRRLVSSEDGRLRRSC
PCCASMDAIKSTLKDSADEFERRFHQGFSDLSVQLHITPDTAYQNFKRVLDELFKDGINW
GRVVGLFVFGGALCVECVERNMGELVSRIAEWMTQYLDEQISPWIHSHGGWDCFARLYGQ
NGAAEARRFQETLKKWMLVTVALLTGLLLGVLITKKR
NT seq 654 nt   +upstreamnt  +downstreamnt
atgtcccactgtaacagagagctggtccggttctatttagcctataagatgtcatgcagg
gactatcctgtgtccctgctgaagcccacagacgatgggggagaaactgaagaggaccac
tccgatgcccggaatcgcaggctggtcagcagtgaggacggccggctgaggaggtcctgt
ccctgttgtgctagcatggacgccatcaaatcaactctcaaagattcggccgatgagttt
gaacgtcgtttccatcaaggttttagtgatctctccgtgcagcttcatatcactccagac
acggcctaccaaaacttcaaaagggtgttggatgagctgttcaaggatgggatcaactgg
gggcgcgttgtgggtttgtttgtctttggtggtgcgctgtgtgtcgagtgtgtcgagagg
aatatgggtgagctggtctcccgcattgctgaatggatgacccagtacctggatgagcaa
ataagtccatggatccacagtcatggaggatgggattgctttgcacggctgtatggccag
aacggcgctgcagaagcgaggagatttcaagagacgctgaagaagtggatgctggtcaca
gtggcccttttaactggactgctgctgggtgtgctcatcaccaagaaacggtga

DBGET integrated database retrieval system