KEGG   Oryzias latipes (Japanese medaka): 101159747
Entry
101159747         CDS       T02443                                 

Definition
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04010  MAPK signaling pathway
ola04012  ErbB signaling pathway
ola04068  FoxO signaling pathway
ola04114  Oocyte meiosis
ola04140  Autophagy - animal
ola04150  mTOR signaling pathway
ola04210  Apoptosis
ola04218  Cellular senescence
ola04261  Adrenergic signaling in cardiomyocytes
ola04270  Vascular smooth muscle contraction
ola04350  TGF-beta signaling pathway
ola04370  VEGF signaling pathway
ola04371  Apelin signaling pathway
ola04510  Focal adhesion
ola04520  Adherens junction
ola04540  Gap junction
ola04620  Toll-like receptor signaling pathway
ola04621  NOD-like receptor signaling pathway
ola04625  C-type lectin receptor signaling pathway
ola04810  Regulation of actin cytoskeleton
ola04910  Insulin signaling pathway
ola04912  GnRH signaling pathway
ola04914  Progesterone-mediated oocyte maturation
ola04916  Melanogenesis
ola05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101159747
   04012 ErbB signaling pathway
    101159747
   04350 TGF-beta signaling pathway
    101159747
   04370 VEGF signaling pathway
    101159747
   04371 Apelin signaling pathway
    101159747
   04068 FoxO signaling pathway
    101159747
   04150 mTOR signaling pathway
    101159747
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101159747
  09143 Cell growth and death
   04114 Oocyte meiosis
    101159747
   04210 Apoptosis
    101159747
   04218 Cellular senescence
    101159747
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101159747
   04520 Adherens junction
    101159747
   04540 Gap junction
    101159747
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101159747
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101159747
   04621 NOD-like receptor signaling pathway
    101159747
   04625 C-type lectin receptor signaling pathway
    101159747
  09152 Endocrine system
   04910 Insulin signaling pathway
    101159747
   04912 GnRH signaling pathway
    101159747
   04914 Progesterone-mediated oocyte maturation
    101159747
   04916 Melanogenesis
    101159747
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101159747
   04270 Vascular smooth muscle contraction
    101159747
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101159747
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ola01001]
    101159747
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ola03036]
    101159747
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ola04147]
    101159747
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101159747
Protein kinases [BR:ola01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101159747
Chromosome and associated proteins [BR:ola03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     101159747
Exosome [BR:ola04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101159747
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH YukC Choline_kinase Kdo FTA2 NDUF_B4
Other DBs
NCBI-GeneID: 101159747
NCBI-ProteinID: XP_023813440
LinkDB
Position
8
AA seq 389 aa
MADSCSTAAVGAEGSDSAAAAGAVGAVAQNEAGGSKPCSESVRGQNFDVGPRYTNLSYIG
EGAYGMVCSALDNLTNQRVAIKKISPFEHQTYCQRTLREIKILLRFNHENIIGINDILRA
RHIDNMRDVYIVQTLMETDLYKLLKSQRLSNDHVCYFLYQILRGLKYIHSANVLHRDLKP
SNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYSKSIDIW
SVGCILAEMLSNKPIFPGKHYLDQLNHILGVLGSPSQEDLNSIINVKARNYLQSLPEKPK
VPLEKLFVKADPKALDLLGRMLTFNPVKRISVEDALAHPYLEQYYDPNDEPVAEEPFTFS
MELDDLPKETLKEMIYEETARFVKNYQGS
NT seq 1170 nt   +upstreamnt  +downstreamnt
atggcggattcgtgcagcactgcagcggttggggccgagggctccgacagcgctgctgct
gccggggcggttggtgctgttgcgcagaatgaagccggagggtccaagccctgctcggag
tcggtgaggggccagaattttgacgttggcccccgctacacgaacctgtcttacatcggc
gaaggagcttatggaatggtctgctctgccctggataacttgacaaatcagcgcgtggcc
atcaagaaaatcagtccattcgagcaccagacgtactgccagcgcactctgagagaaatc
aagatcctgctgcgcttcaaccacgagaacatcatcgggattaacgacatcctgagggcg
cggcacattgataacatgagggatgtctacatcgtgcagaccctgatggagaccgatctg
tacaagctgctgaagagccagaggctaagcaacgaccacgtctgctacttcctctaccag
atcctgcgaggcctcaagtacatccactctgccaacgtgctgcaccgtgacctcaagccc
tccaacctgctcatcaacaccacctgcgacctcaagatctgtgacttcggcttggctcgg
atagctgatccagagcacgaccacaccggcttcttgactgagtatgtggccactcgttgg
tacagagctccggaaatcatgctcaactcaaagggttactccaagtctattgacatctgg
tcggtgggctgcatcttagctgaaatgctgtctaataagcctatattccctggaaagcac
tacttggaccagctcaaccacattctaggtgttcttggctctccatctcaagaagatctg
aacagcatcataaacgtcaaggccaggaactatttgcagtccctgcctgagaaaccgaag
gtccccctggagaagctctttgtcaaggcagatccaaaagctctggatctgttgggccgc
atgctgacctttaaccctgttaagcgcatcagcgttgaagacgcactggctcacccttac
ctggagcaatactatgaccccaatgatgagcctgtagcagaggagcctttcacgttctcc
atggaactggatgatctgcccaaggagacgctgaaggaaatgatctatgaagaaactgct
cgtttcgtgaaaaactaccagggatcatga

KEGG   Oryzias latipes (Japanese medaka): 101162905
Entry
101162905         CDS       T02443                                 

Definition
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04010  MAPK signaling pathway
ola04012  ErbB signaling pathway
ola04068  FoxO signaling pathway
ola04114  Oocyte meiosis
ola04140  Autophagy - animal
ola04150  mTOR signaling pathway
ola04210  Apoptosis
ola04218  Cellular senescence
ola04261  Adrenergic signaling in cardiomyocytes
ola04270  Vascular smooth muscle contraction
ola04350  TGF-beta signaling pathway
ola04370  VEGF signaling pathway
ola04371  Apelin signaling pathway
ola04510  Focal adhesion
ola04520  Adherens junction
ola04540  Gap junction
ola04620  Toll-like receptor signaling pathway
ola04621  NOD-like receptor signaling pathway
ola04625  C-type lectin receptor signaling pathway
ola04810  Regulation of actin cytoskeleton
ola04910  Insulin signaling pathway
ola04912  GnRH signaling pathway
ola04914  Progesterone-mediated oocyte maturation
ola04916  Melanogenesis
ola05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101162905
   04012 ErbB signaling pathway
    101162905
   04350 TGF-beta signaling pathway
    101162905
   04370 VEGF signaling pathway
    101162905
   04371 Apelin signaling pathway
    101162905
   04068 FoxO signaling pathway
    101162905
   04150 mTOR signaling pathway
    101162905
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101162905
  09143 Cell growth and death
   04114 Oocyte meiosis
    101162905
   04210 Apoptosis
    101162905
   04218 Cellular senescence
    101162905
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101162905
   04520 Adherens junction
    101162905
   04540 Gap junction
    101162905
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101162905
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101162905
   04621 NOD-like receptor signaling pathway
    101162905
   04625 C-type lectin receptor signaling pathway
    101162905
  09152 Endocrine system
   04910 Insulin signaling pathway
    101162905
   04912 GnRH signaling pathway
    101162905
   04914 Progesterone-mediated oocyte maturation
    101162905
   04916 Melanogenesis
    101162905
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101162905
   04270 Vascular smooth muscle contraction
    101162905
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101162905
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ola01001]
    101162905
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ola03036]
    101162905
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ola04147]
    101162905
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101162905
Protein kinases [BR:ola01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101162905
Chromosome and associated proteins [BR:ola03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     101162905
Exosome [BR:ola04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101162905
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH FTA2 Choline_kinase Kdo Kinase-like
Other DBs
NCBI-GeneID: 101162905
NCBI-ProteinID: XP_023813884
LinkDB
Position
9
AA seq 369 aa
MATAAVSASAGCGPSPGPGTELVRGQAFDVGPRYSNLSYIGEGAYGMVCSAYDRDNKIRV
AIKKISPFEHQTYCQRTLREIKILLRFKHENIIGINDIIRAPSIEQMKDVYIVQDLMETD
LYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLA
RVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGK
HYLDQLNHILGILGSPSQEDLNCIINIKARNYLLSLPLRCKVPWNRLFPNADPKALDLLD
KMLTFNPHKRIEVEQALAHPYLEQYYDPTDEPVAEAPFKFDMELDDLPKETLKEYIFEET
ARFQPGFRS
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggcgacagctgcggtgtcggcctccgccggctgcggccccagccccggcccgggcacg
gagctggtccgcgggcaggccttcgacgtggggcctcggtacagcaacctgtcctacatc
ggggagggcgcgtacgggatggtgtgctcggcgtacgaccgcgacaacaagatccgcgtg
gccatcaaaaagatcagccccttcgagcaccagacctactgccagcgcacgctgagggag
atcaagatccttctgcgcttcaagcacgagaacatcatcggcatcaacgacatcatccgc
gcgccgagcatcgagcagatgaaggacgtatacatcgtccaggacctcatggagacggac
ctgtacaagctcctgaagacccaacacctgagcaacgaccacatctgctacttcctctac
cagatcctacgagggctcaagtacatccactctgccaacgtcctgcaccgcgacctgaag
ccctccaaccttctgctcaacaccacctgtgatctgaagatctgtgatttcggtctggcc
cgtgtggcggatcccgaccacgatcacactggtttcctcacagagtacgtggccacacgc
tggtaccgagctcctgagatcatgctcaactccaagggctacaccaagtccatagatatc
tggtcagtgggttgcatcctcgccgagatgttgtccaacaggccaatcttccctgggaag
cactacctggatcagctcaaccacattttggggatcctgggctctccgtcccaagaagac
ctgaactgcatcatcaacatcaaagccaggaactatctgctgtcgctgcctctgcgctgc
aaagtgccctggaaccgcctcttccccaacgccgaccccaaagctctggacctgctggac
aagatgctgacctttaaccctcacaagaggatcgaggtggagcaggctctggcacacccc
tacctggagcagtactacgaccccacagacgagcccgtcgctgaggcgccgttcaaattc
gacatggagctggatgacttacccaaagagaccctgaaggagtacatctttgaggaaacg
gcccgttttcagcccgggttcaggtcctaa

DBGET integrated database retrieval system