KEGG   Oryzias latipes (Japanese medaka): 101160207
Entry
101160207         CDS       T02443                                 

Definition
(RefSeq) uncharacterized protein LOC101160207
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04012  ErbB signaling pathway
ola04068  FoxO signaling pathway
ola04110  Cell cycle
ola04115  p53 signaling pathway
ola04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101160207
   04068 FoxO signaling pathway
    101160207
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101160207
   04115 p53 signaling pathway
    101160207
   04218 Cellular senescence
    101160207
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 101160207
NCBI-ProteinID: XP_023808089
LinkDB
Position
23
AA seq 264 aa
MTVFDGNHVTSSSRRTSPSLLPLGLHSPKQTRLRSGDKFGQCLLKTSQRETVYIHGTVTH
TLRCSDCVEGEKVTARLENVHFGKRRWDMAVASTSTSTGPAMASDSELSRLGGIEALKLT
VGPTRRNLFGPVDHQQLQKDFQRLLCMNMEVANKRWNFDFQRDTPGEGSGVEWVGLRCQD
VPAFYHSCTVRPASRAAKATRRASTSSGEGSPMSCSFSGDEYLEVTTRGCFPIKLSGKRR
QSNITDYFKVKKRKLLHSKVSSRQ
NT seq 795 nt   +upstreamnt  +downstreamnt
atgactgtttttgatgggaaccacgtgaccagctcctctcgtaggacgtccccctccctc
ctccccctcggtcttcatagtccaaaacaaacacgtctcagatcaggggacaaatttggg
cagtgcctgctaaaaacctctcaacgtgaaactgtttatatccacgggactgtcactcac
acgttgcgttgctctgactgcgtggaaggagaaaaagttacggctcgacttgaaaacgtc
cactttggcaaacgccgatgggacatggctgttgcttctacatcgacttcaaccggaccg
gcgatggcgtccgactctgagctctcccgcctcggaggcatcgaggccctaaagttgacg
gtggggccgacccgaaggaatcttttcggcccggtcgaccaccagcagctgcagaaggac
ttccagcggctgctctgcatgaacatggaggtggccaacaagcgctggaactttgacttc
cagagggacactcccggggagggctccggcgtggagtgggtggggctcaggtgccaggac
gtgccggcgttttaccacagctgcaccgtgcggcccgcgtccagggctgcgaaggccaca
cggagggcgtcgacgtcatctggagagggctcccccatgtcctgcagcttctctggggat
gaatatctggaggtgaccaccagggggtgctttcccatcaagctctcagggaagcgcaga
cagtccaacatcacagattacttcaaggtgaagaaaaggaagcttctgcattccaaagtg
tcttctcggcagtag

DBGET integrated database retrieval system