KEGG   Oryzias latipes (Japanese medaka): 101161071Help
Entry
101161071         CDS       T02443                                 

Gene name
galnt17
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 17
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00512  Mucin type O-glycan biosynthesis
ola01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    101161071 (galnt17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ola01003]
    101161071 (galnt17)
Enzymes [BR:ola01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     101161071 (galnt17)
Glycosyltransferases [BR:ola01003]
 O-Glycan biosynthesis
  Mucin-type
   101161071 (galnt17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_transf_7C RicinB_lectin_2
Motif
Other DBs
NCBI-GeneID: 101161071
NCBI-ProteinID: XP_023817448
LinkDB All DBs
Position
13
AA seq 600 aa AA seqDB search
MAFVFRRWRVLLLLNVLAVAGFMTFWTKCNTRSVRAAGPEAPPADGRWLRANGTAQGPSI
SHEVLLKRLSSLEDVVYRQLNGLSKSLGLIEGFGGRGKGGLAATLLPGEESDAKHLRDKY
GYNAYLSDRISLDRTIPDHRPSKCRKVSYPRDLPQISLIFIFVNEALSVILRSVHSAVNH
TPAHLLKEIILVDDNSDDEQLKAPLEEYVNKRYPGLVKIVRNQKREGLIRARIEGWKVAT
AEVTGFFDAHVEFTPSWAEPVLARIKEDHRRIVLPSIDNIKHDTFEVERYENSGHGYNWE
LWCMYINPPKQWWDEGDMSAPIRTPAMIGCSFVANRDYFADLGLLDSGMDVYGGENIELG
IRVWLCGGSMEVLPCSRVAHIARMKKPYHSNIAFHMRRNALRVAEVWMDEYKSNVYLAWN
IPMENHGIDYGDISQRVVLRKNLQCKSFQWYLDNVYPEMRRYNNTLFYGEIRNSKVSHLC
MDQGMKENHTAILHPCHGWGPQLGRYTKDSQLFLGPLGSTGEDTRCVVDDQVSSFPQLLH
CDKVTNVKQKTWQFSQNDWIKNRATGRCLEVVPANVYFGHLLVLQPCTGQRWTIKNAMKH
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgtgtttcgaagatggagggttctgctgctgctcaacgtgctcgccgtcgcc
ggcttcatgacattctggaccaagtgcaacacccgcagcgtccgagccgccggtccggag
gctccgccggcggacggcaggtggctccgggccaatgggaccgcgcaggggcccagcatc
agccacgaagtgctgctgaagaggctcagctctctggaggatgtggtttaccgccagctg
aacggcctttccaaatccctgggcttgattgaaggcttcgggggtcgaggtaaaggcggc
ctcgctgccacgctgttaccgggcgaggaaagcgacgccaaacacctgcgggacaagtac
ggctacaacgcttacctcagtgacagaatctctctggatcggaccattccggaccaccgg
ccgagcaaatgcaggaaggtcagctacccaagagatcttccacagatctccctcatcttc
atctttgtcaacgaggccttatctgtgattctgcgatcggtccactcggctgtcaatcat
acgccggctcacctgctcaaagagatcatcttggtggacgacaacagcgatgacgagcag
ctgaaggcaccgctggaggagtatgtcaacaagcgctacccgggcctggtgaagatagtg
aggaaccagaagagagaggggctgatccgggccagaatcgagggctggaaggtggccacg
gcagaggtgacaggatttttcgatgcccatgtggaattcaccccttcatgggcagaaccg
gttcttgccagaataaaagaggaccacaggaggatcgtcctgccttccatcgacaacatc
aagcacgacacattcgaggtggagcgatacgagaactcgggccatggctacaactgggag
ctttggtgcatgtacatcaatccccccaagcagtggtgggacgagggagacatgtctgct
cccattaggactcctgccatgattggctgctcctttgtcgccaaccgtgactattttgca
gacttgggtctgctggactctggcatggacgtctatggaggggagaacatcgagctgggg
atcagggtgtggctgtgtgggggcagtatggaggtgctgccctgctccagagtggctcac
atcgctcgaatgaagaagccctaccacagtaacattgccttccacatgcggcggaacgct
ctccgtgttgccgaggtgtggatggatgagtacaagtccaacgtttaccttgcctggaat
attcccatggagaatcacggcattgattatggagatatttctcaaagagttgtcctgagg
aagaacctgcagtgcaagagcttccagtggtacctggacaatgtttacccggagatgagg
aggtacaacaacacgctgttctacggtgagatccgtaactctaaagtaagccatctgtgc
atggatcagggcatgaaggagaaccacacagccatcctccatccctgccatggctggggt
cctcagctgggacgctacaccaaggacagccagctgttcctgggcccgctgggaagcacc
ggcgaggacactcggtgcgtggtggacgatcaggtcagcagcttcccacagctcctccac
tgtgacaaagtgaccaatgtgaagcagaagacatggcagttctctcagaacgactggatc
aagaaccgagccaccgggcgttgcctggaggttgtgcctgccaacgtgtacttcggccac
ctgctggtcctgcagccgtgcaccggccagagatggaccatcaagaacgccatgaagcat
taa

DBGET integrated database retrieval system