KEGG   Oryzias latipes (Japanese medaka): 101161174Help
Entry
101161174         CDS       T02443                                 

Definition
(RefSeq) prostaglandin G/H synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00590  Arachidonic acid metabolism
ola01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    101161174
Enzymes [BR:ola01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     101161174
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF DctM
Motif
Other DBs
NCBI-GeneID: 101161174
NCBI-ProteinID: XP_011479871
LinkDB All DBs
Position
12
AA seq 597 aa AA seqDB search
MRTSIFGCVFVLLLLLREPGCHGEEVTSSTAVNPCCHYPCQHWGVCVRTTQEEYECDCTR
TGYYGENCTIPEFLTRVRQFLKPSPKVVHYILTHFHWLWDVINNTFLRDTLMRLVLTVRS
NLIPNPPTFNSKYGYLNWESYYNLSYYTRILPPVPEDCPSPMGVKGRSQLPDPEVVVERL
LKRRTFRPDPQGSNLMFAFFAQHFTHQFFKTYNRMGVGFTKALSHGVDAGHIYGDNLERQ
LALRLFKDGKLKYQVIDGQVFPPSVVDAAVYMSYPPGVPPEHQMAIGQEVFGLLPGLGLY
ATLWLREHNRVCDVLKAEHPVWDDEQLFQTARLIIIGETIRIVVEEYVQHLSGYLLDLKF
DPTLLFNSQFQYGNRIALEFSQLYHWHPLMPDSFHINGDELSYKHFLFNTSILTHYGVEK
LVDSFSRQIAGQIGGGHNINAVVTHVAVSTIKESRQLRIQPFNEYRKRFNLEPYASFREF
ADNEEIAQTLEELYGDIDALEFYPGLMLEKTRPGAIFGESMVEMGAPFSLKGLLGNPICS
PDYWKPSTFGGKVGFDIVNTASLKKLVCLNSRTCPYVSFQVPAEEKSQPGKECPDEL
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgagaacctctatctttggatgcgtgtttgttctccttctgctgttaagggagccaggt
tgccacggggaggaggtcacctccagcacagcagtcaatccatgctgtcactacccctgc
cagcactggggcgtgtgcgtgcgcaccacacaggaggagtatgagtgtgactgcacccgc
accggctactatggagagaactgcaccatccctgagtttttgaccagggtgcgtcagttc
ctcaaaccaagcccaaaagtggtgcattacattctcacacatttccactggctgtgggac
gtcatcaacaacactttcttgcgggacaccctcatgcgtttagttttaacagtgagatcc
aacttgatacccaaccctccaactttcaactcaaagtatggctacctcaactgggaatcc
tactacaatctcagctactacactcgaattctgccccctgtgccggaagactgcccatca
cctatgggagtcaaagggaggagccagctgcctgacccagaggttgtggtggagaggctg
ctgaagagaaggacattcagacctgaccctcagggctccaacctcatgtttgctttcttc
gcccaacacttcactcaccagttcttcaagacctacaaccgcatgggtgtgggcttcact
aaggctctgagccatggggtggatgcaggacacatttatggagataacctggaacgtcag
ctggctcttcggctttttaaagacggaaaactgaaatatcaggttattgatggacaggtg
ttccctccctctgtggtcgatgcagcggtttacatgagctacccccccggagttccccct
gagcatcaaatggccatcggtcaggaggtgtttggactcctaccaggtttgggtctgtac
gccactctgtggctgcgggagcacaaccgcgtctgtgacgtcctgaaggcggagcatcct
gtgtgggacgacgagcagcttttccagacggctcgcttaatcattattggtgagacgata
cgaatcgtcgttgaggagtacgtgcagcatctcagcggctacctgctggacctgaagttt
gaccccacactgctgttcaactcccagttccagtatggaaaccgcatcgcgctggagttc
agccagctgtaccactggcaccctttgatgccggacagcttccacataaacggagatgag
ctgtcgtacaaacacttcctgttcaacacatctattctgactcactacggcgtggaaaag
ctggtggattccttctcccgccaaattgctggccagattggcgggggccacaacattaat
gctgtggtgacccatgtggccgtgagtacaatcaaggagtcccgccagctccggatccag
cctttcaacgagtacaggaagcgttttaacctggagccgtacgcgtctttcagagagttt
gcggataatgaggagatagcccaaacgcttgaagagctgtatggtgatatcgacgctctg
gaattttaccccggcttgatgttggagaagacgcgaccaggggccatatttggggaaagc
atggtggagatgggtgcacccttctctctcaaaggcctcctggggaaccccatatgttcc
ccggattactggaaacccagcacctttggtgggaaagtcggctttgacatagtgaacaca
gccagcctgaagaagctggtctgtctgaacagcaggacgtgtccgtacgtgtcgttccaa
gttccagctgaggagaaatcacaaccggggaaggaatgtcccgatgagctatga

DBGET integrated database retrieval system