KEGG   Oryzias latipes (Japanese medaka): 101161513
Entry
101161513         CDS       T02443                                 

Gene name
epo
Definition
(RefSeq) erythropoietin isoform X1
  KO
K05437  erythropoietin
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101161513 (epo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ola04052]
    101161513 (epo)
Cytokines and growth factors [BR:ola04052]
 Cytokines
  CSF and other factors
   101161513 (epo)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 101161513
NCBI-ProteinID: XP_004079700
UniProt: A0A2Z5WSJ5
LinkDB
Position
18
AA seq 185 aa
MLRKTGRGLFALLLIVLEWTCPGLLSPLRPICDLRVLNHFIQEARDAEVAMRSCREGCGL
TQTVSVPQTTVNFEDWEKKNALEQAEEVQTGLWLLQQALGSFGPSVTNTALNNHIDNTAR
NLVSINAVLRSLNFQEYTPPANASSLDGTWTVSSATELLQVHVNFLRGKVRLLLMDAPAC
QQDVS
NT seq 558 nt   +upstreamnt  +downstreamnt
atgttgcggaaaacgggcagaggactgtttgccttgctgttgattgtgttggagtggacc
tgcccaggcctactatccccactgcggccaatctgtgacctgagggtcctaaaccatttc
atccaggaagcacgagacgcagaagtcgctatgaggtcatgcagagaaggatgtggccta
acacagacggtctctgttccccaaactacagtcaacttcgaggactgggagaagaaaaat
gcactagagcaagctgaggaagtgcagaccggcttgtggctgttacagcaggccctcggc
tcatttggaccatcggtcaccaacacggcgctgaacaaccacatagacaacactgccaga
aacctggtcagcatcaatgctgtgctgcgtagcctcaattttcaggaatacacaccgccg
gcaaacgcgtcgagtctggacggcacatggacagtgtcctcggcaacggagctgcttcaa
gtccacgtgaacttcctgcgaggaaaagtgcgccttcttcttatggacgcgccggcgtgc
cagcaagatgtcagctga

DBGET integrated database retrieval system