KEGG   Oryzias latipes (Japanese medaka): 101161547
Entry
101161547         CDS       T02443                                 

Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
ola  Oryzias latipes (Japanese medaka)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 C1_2
Other DBs
NCBI-GeneID: 101161547
NCBI-ProteinID: XP_004068565
UniProt: H2LA77
LinkDB
Position
5
AA seq 570 aa
MISFISKLSTTVYSHVSLELLLFAINCSSSCRERLKTVSFCSNTRFFLFGIGERSLLFLQ
DEGHMHALIMKTTLLLFMNDSERGACAPREAQTKNRTVARVNVRRGESSSCAAAVTHEGI
RSAVIPRSQCMRKPKCARLWRGCPPVIQRYPPKRLKTPAGLTSTRSLLLGLGSFVAEIHQ
RCKGAAPALPSPLRAPHLSSHVKSNTSHVRVCTMSKCELIELKDLSLNDPIELAAPSVHN
TPPPVKSGQTSHHRVVRLVGDIVNIETSVHHPEEAALGHSFQPYSYTHLTWCDLCGEFIW
GLYQKSLRCTNCSYTCHYRCQPFIQLKCSAPGSGSTETDTDDSIESDTNVDEQITIGLHD
LTPAEIQQRVKEYNAQINNNLYMVDNKDGSFTGFIKVHFQLVRPVSLPPLPQCQGLVQGE
EQQGRCMKRRTSFYLPKDSAKHLHISSETRVREVIQALLNKFTVVDNPAKFALFERTEKQ
SYVSMRKLSADERPLHLRLCAGPSETLLCLVLKENDTGDVNWDAFSFPELCNFLQILQRE
EEEHVRQIVRRYTLAKERIKQAMAQINTPG
NT seq 1713 nt   +upstreamnt  +downstreamnt
atgatttcttttattagtaaactgtcaacaacggtttattcccatgttagccttgagtta
ctcttatttgccataaattgttcttcatcttgtagagaaagattgaaaactgtttctttt
tgttccaacaccagattcttcctgttcgggattggggaaagatctctgcttttcctgcag
gatgagggacacatgcatgctttgattatgaaaactacccttctgctcttcatgaatgat
tcagagaggggagcctgtgcgcccagggaggcgcaaacgaagaaccgcactgtcgctcgc
gtaaatgtgcgcagaggggaatcctcatcctgtgccgctgctgtcacgcatgaggggatt
agaagcgccgtaatcccgcgctcacagtgcatgcgcaaacccaagtgcgcgcgcctgtgg
aggggctgcccgccggtcattcagcgatatcctcctaaacgtctgaagacaccagcagga
ctgacgtcaacacgctccctcctgttgggcctcgggagcttcgtggcagaaattcaccag
cgatgcaaaggagcagctcctgctttgccgtcccctcttagggctccacacctgtcctca
cacgtgaagagcaacacgtcacatgtgagggtctgcaccatgtccaaatgtgaactgatt
gagctgaaggacctcagtttaaatgatcccatcgagctggcggctccatccgtccacaac
accccgccacccgtaaagtcaggtcagaccagccaccaccgcgtcgtccgtctggttggc
gacatcgtcaacatcgagacttccgtccaccacccagaagaagctgctcttggtcacagt
ttccagccctacagctacacacacctcacctggtgtgacctttgtggggaattcatctgg
ggtctttatcaaaagagtttgcgctgcaccaattgcagttacacttgtcactaccgctgc
caacccttcatccagctgaagtgcagcgctcctggaagtggatcaacagagaccgacacg
gatgactccattgagagcgacactaatgtggatgaacagattacaataggtttacacgat
ctgactcctgcagagattcagcaaagggtcaaagagtataatgcccagattaataacaat
ctgtacatggtggataataaagatggctccttcactggtttcatcaaagttcactttcag
ttggttcgccccgtctcactgcctcctcttcctcagtgccagggtctggtgcagggggaa
gagcagcagggcaggtgcatgaagcgacggacatctttctacctccccaaagacagcgca
aagcacctgcacataagctcggaaacacgggtacgagaggtcatccaagcgttgctcaac
aagttcaccgtggtggacaacccagcaaagtttgccttgtttgagcgcacagagaaacag
agctatgtgtccatgcgtaaactctctgccgacgagcgtcctttacacctgcgcttgtgt
gccggccccagcgaaacccttctgtgtctggttttaaaggagaacgacacaggagacgta
aactgggatgcctttagctttcccgaattgtgcaactttctgcaaatcttgcagcgtgag
gaagaagagcatgtgcggcagattgtgagacgctacactctcgctaaagaaaggataaaa
caagccatggctcagatcaacactcctggttga

DBGET integrated database retrieval system