KEGG   Oryzias latipes (Japanese medaka): 101161640Help
Entry
101161640         CDS       T02443                                 

Gene name
gaa
Definition
(RefSeq) lysosomal alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00052  Galactose metabolism
ola00500  Starch and sucrose metabolism
ola01100  Metabolic pathways
ola04142  Lysosome
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101161640 (gaa)
   00500 Starch and sucrose metabolism
    101161640 (gaa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    101161640 (gaa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ola04147]
    101161640 (gaa)
Enzymes [BR:ola01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     101161640 (gaa)
Exosome [BR:ola04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101161640 (gaa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 101161640
NCBI-ProteinID: XP_004071504
LinkDB All DBs
Position
8
AA seq 924 aa AA seqDB search
MGLLSSLTTALLLLAFSLFVLFYSFTRFSNNGVPLVRSVNYSYNDPKAQKTSKGDIHRAS
WRTFGFPTERECTIDPESRFDCGRDRLLSQGECEDRGCCFSPLPSPVGPPWCFYPRWYPG
YKMGPFSPSTHGKTASLTRAKPSYLFKEISPLTLEVMEESADCLHLTIKDPFTQRYEVPL
PEGVSHTKADAQDVLFTVEFHSEPFGFIVRRATNGRVIMNTTVAPLLFADQYLQMSTTLA
SSFVSGLGEHYTSLVLDLNWTSLTLWNRDMAPHADANLYGSHPFYMVQEEGGLAHGVFLL
NSNAIEVILQPTPALTWISTGGILDLYVFMGPDPQSVIRQYLQVIGYPMMPPYWSLGFHL
CRWGYTSSNATRSVAQHMHSANFPMDVQWNDLDYAHERKVFTFDPMRFGDLPEMVEEFHE
RGMKYILILDPGISSTSPPRTYPPFEDGVKRDVFVKNAMGEILIGKVWPGPTAFPDFTNV
ETRQWWEDCIRNFYSEVPVDGLWIDMNEPASFVQGSVEGCPDNDLERPPYTPRMVGGQLN
SGTLCMSAQQKLSTHYNLHNLYGLTEAYATHSALKKIQRKRPFVLSRSSFPGIGRFSAVW
TGDVQSDWEQLGFSIPAVLQFSLFGVPLVGADICGFGGNTTEELCVRWMQLGAFYPFMRN
HNDKPNAPQEPFVFGQKAQAAMRRAVNLRYSLLPFLYTLFHHAHTSAATVARPLFMEFPS
DPNCKSIDQQFLWGGSLLISPVLKQGAVKVKAYLPLGTWYSLYNGQAFHSKGQFFLLPAP
LDTINIHVRQGHIIPQQEPALTTAASRRKPFFLIAALSGDGSARGDLFWDDGESLDTFEM
QNYSYIIFTAVQFQIVSEPLKLNGALDGLVLAGVQVFGVLSAPIYVLANGEKVLDFAYQA
DTKVLTVTNLALPMSKPFTIQWAS
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
atgggactattgtccagtttaacaaccgctctgctcctcctcgccttttctttgtttgtt
ttgttttatagcttcacccgcttttccaacaatggagttccgcttgtcagatcagttaat
tacagctacaacgacccaaaagcacagaaaacgtcaaagggcgacatccaccgagccagt
tggcgcacattcggctttcccacagaacgcgaatgcaccattgacccagagagtcggttt
gactgcggccgggacaggctgctgagtcagggggagtgtgaggacagagggtgctgcttc
tcccctctgccctcccctgttggacccccttggtgcttctacccccgctggtaccctgga
tataaaatgggtcccttctctcccagcacacatggcaaaactgcaagcctgacaagagcc
aagccctcctatctttttaaggaaatctcccccctgactcttgaggtgatggaggagtct
gcagactgcttacatctcaccatcaaggaccccttcactcaaaggtatgaagttccactt
ccagaaggagtttctcataccaaagctgatgctcaggatgtcctctttactgttgagttt
cactccgaaccatttggtttcatagtgcggcgagcaacaaatggaagagtgattatgaac
acgacagttgctcctctgctgtttgctgaccagtacctgcagatgtccaccacattggcc
tcttcgtttgtgtctggcctcggggagcattacacctctctggtcctggacctgaactgg
acgtctctgactctctggaacagagacatggcacctcatgcagatgctaacttgtatggc
tcccatccgttttacatggtacaggaggaggggggtttagcacatggtgtttttcttctg
aacagcaatgcaattgaagtgattctccagccaactccagctctcacctggatatctact
ggtggaatcctggacctgtatgtcttcatgggtcctgacccccaaagtgttataagacag
tacctccaggttattggataccccatgatgccgccctattggtcacttggctttcatctt
tgccgctggggttataccagctctaatgcaacacggagtgttgcacagcacatgcacagt
gccaattttcctatggatgtgcagtggaatgacctggattatgcacatgaacgaaaggtg
ttcacctttgaccccatgcgatttggagacctgccagaaatggttgaggagtttcatgag
agagggatgaagtacatcctgattctggacccaggaatcagcagcaccagcccccccagg
acctaccctccttttgaagatggggtcaaacgagatgtctttgttaaaaatgcgatgggg
gaaattctgattggcaaggtttggccgggcccaactgcttttcctgatttcaccaacgtg
gaaacgaggcaatggtgggaggactgcatcagaaacttttattctgaagttcctgtcgat
ggtctgtggattgatatgaatgaaccagccagttttgttcaaggctcagtggagggctgt
cctgacaatgatctcgagagaccaccttacactcccagaatggttggaggtcagctgaac
tcaggaactctttgcatgtcagctcaacagaagctgtccacacactacaacctgcacaac
ctatacggactgactgaagcttatgcaacacacagtgccctcaagaagattcagaggaag
aggccctttgtcctgtctcgctcctccttccctggcatcggacgattctccgctgtgtgg
acaggagatgttcaaagtgactgggagcaacttggattctccatccctgccgtgctgcag
ttcagcctgtttggagtgcctctggtaggagcagacatctgtggctttggaggaaacacc
acagaggagttgtgcgtcagatggatgcagcttggagccttctacccattcatgagaaac
cacaatgacaaacctaatgcacctcaggagccatttgtatttgggcagaaggctcaggca
gctatgagaagggccgtgaatcttcggtactctcttctccccttcctctacactctcttc
caccatgctcacacctccgcagccacagttgcccggcctctctttatggagtttccctcg
gaccccaactgtaagagcatagaccaacaattcttgtgggggggttcacttcttatcagc
ccggttttgaagcaaggagcagtaaaagtcaaagcctacctgccacttggcacttggtac
agcttgtacaatggtcaggccttccacagtaagggtcagttctttcttttgccagcccca
ctggacacaatcaacattcatgtgaggcaaggacacattataccccaacaggagccagct
ttgacaactgcagcctctcgccgaaagcctttcttcctgatagctgctctgtcaggagac
ggctcagctcgcggtgacttgttctgggatgacggggaaagtcttgacacttttgaaatg
caaaattacagttacatcatcttcacagcagtacagttccagattgttagtgaacccctt
aagctgaacggggccctagacggtttggtgttggcgggtgttcaagtgtttggggtcctc
tcggcacctatttatgttttggcaaacggagaaaaagtccttgattttgcatatcaagca
gacactaaagttttgacagtgaccaacctggccttgcccatgtcaaagcccttcacaatc
cagtgggcttcctga

DBGET integrated database retrieval system