KEGG   Oryzias latipes (Japanese medaka): 101161650
Entry
101161650         CDS       T02443                                 

Definition
(RefSeq) putative fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04010  MAPK signaling pathway
ola04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101161650
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101161650
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ola04052]
    101161650
   00536 Glycosaminoglycan binding proteins [BR:ola00536]
    101161650
Cytokines and growth factors [BR:ola04052]
 Growth factors
  Growth factors (RTK binding)
   101161650
Glycosaminoglycan binding proteins [BR:ola00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   101161650
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 101161650
NCBI-ProteinID: XP_004073542
UniProt: H2LND4
LinkDB
Position
10
AA seq 157 aa
MADAEMTAELGQSADGGPPLLDYRRPTRLYCRNGGHHLQIPPDGTVRGERDERDAHIVLK
LKAVDRGVVIIQGTESQRYLAMNDEGRLYSSPAVTDECFFLENLEENFYNTYRAQKYQDN
NWFVGLKKNGKPKLGPRTHIGQKAVFFLPRQLEDKSD
NT seq 474 nt   +upstreamnt  +downstreamnt
atggcggatgcggagatgaccgcagagctgggtcagtccgcggacggcggcccgcctctg
ctggactaccggcggccgacccgcctctactgccggaacggcggacatcacctgcagatc
ccgcccgacgggacggtgcggggcgagcgggatgagcgggacgctcacatcgttttaaag
ctgaaggctgtggacagaggtgtcgtcatcatccaaggaactgaatcccagcgatacttg
gccatgaatgatgaaggacggctgtacagttcccctgcagtaactgatgagtgtttcttt
ctggagaacctggaggagaatttctacaacacataccgagcacagaaatatcaggacaac
aactggtttgtaggccttaaaaagaacgggaagcctaagctgggtccgagaacccacatc
ggacagaaggcggtcttctttcttcccagacagctagaagacaagtccgactga

DBGET integrated database retrieval system