KEGG   Oryzias latipes (Japanese medaka): 101161880
Entry
101161880         CDS       T02443                                 

Gene name
cdk2
Definition
(RefSeq) cyclin-dependent kinase 2
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04068  FoxO signaling pathway
ola04110  Cell cycle
ola04114  Oocyte meiosis
ola04115  p53 signaling pathway
ola04218  Cellular senescence
ola04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101161880 (cdk2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101161880 (cdk2)
   04114 Oocyte meiosis
    101161880 (cdk2)
   04115 p53 signaling pathway
    101161880 (cdk2)
   04218 Cellular senescence
    101161880 (cdk2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    101161880 (cdk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ola01001]
    101161880 (cdk2)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ola03032]
    101161880 (cdk2)
   03036 Chromosome and associated proteins [BR:ola03036]
    101161880 (cdk2)
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     101161880 (cdk2)
Protein kinases [BR:ola01001]
 Serine/threonine kinases: CMGC group
  CDK family
   101161880 (cdk2)
DNA replication proteins [BR:ola03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    101161880 (cdk2)
Chromosome and associated proteins [BR:ola03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    101161880 (cdk2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Haspin_kinase APH Kinase-like Kdo
Other DBs
NCBI-GeneID: 101161880
NCBI-ProteinID: XP_020559138
LinkDB
Position
5
AA seq 298 aa
MDTFQKVEKIGEGTYGVVYKAKNKLTGETVALKKIRLDTETEGVPSTAIREISLLKELSH
PNIVKLQDVIHTENKLYLVFEFLHQDLKKFMDSSSVTGIPLALVKSYLFQLLQGLAFCHS
HRVLHRDLKPQNLLINAQGEIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYY
STAVDVWSLGCIFAEMITRRALFPGDSEIDQLFRIFRTLGTPDETAWPGVTSMPDYKPSF
PKWARQDLSKVVPLLDEDGRELLGEMLKYDPNKRLSAKNALVHRFFRDVTMPVPNLRL
NT seq 897 nt   +upstreamnt  +downstreamnt
atggatacgtttcagaaagtggaaaagatcggagaagggacgtatggagtggtttacaaa
gctaaaaacaaactgaccggagaaacggttgcgctgaagaaaatccgactggatacagaa
acagagggcgtaccaagcacagcgattcgagaaatttcacttcttaaagaactcagtcat
ccaaatattgtcaagttgcaggatgtgattcacacagaaaacaaactctatctggttttt
gagttcctccatcaggacctcaaaaaattcatggactcttcctctgtgactggcatcccg
ctggctttggtgaagagttatctcttccagttgctgcaaggcctggctttctgccactct
cacagagttcttcatcgggacctgaagccccaaaacctcctcatcaacgcccagggtgag
atcaaactggcagacttcggtctggcgagagcttttggagtgccggtccgcacctacact
catgaggtggtaacactttggtacagagccccagaaatcctcctcggctgcaaatactac
tccacagctgtcgatgtctggagtttggggtgcatcttcgctgaaatgatcaccaggagg
gctttgtttcccggagactctgagatcgatcagttattcaggatctttcgcacgctgggc
acacctgacgaaacggcgtggcccggagtcacatccatgcccgactacaagccctccttc
cccaaatgggctcgtcaggatttatccaaagtggttccgcttctagacgaagatggaaga
gagttgctcggagaaatgctgaaatatgacccaaacaaaaggctttctgcaaaaaatgca
cttgtacatcgctttttccgagacgtgaccatgcccgtgcctaacctccgactgtga

DBGET integrated database retrieval system