KEGG   Oryzias latipes (Japanese medaka): 101162234
Entry
101162234         CDS       T02443                                 

Gene name
perp
Definition
(RefSeq) p53 apoptosis effector related to PMP-22
  KO
K10136  TP53 apoptosis effector
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    101162234 (perp)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_3 Clc-like DUF1616 DUF2207
Other DBs
NCBI-GeneID: 101162234
NCBI-ProteinID: XP_004077102
UniProt: H2LJ14
LinkDB
Position
15
AA seq 184 aa
MFRCGLAFPRCRWIVPLLLLFAIIFDIIAIAAKSGWVEDEDAKTHYANMWNEWRGRGGNW
DSRSLMDFPWAQAVAALMIIGLILLIIAFIIAVVSMCNIDVGCMYGTATVLAIVVVIQII
ALIIYPVNFNERIFEGQYFYTWAYGFGWGATILTLGCSILFCCLPQYEDDLRGEKKINYF
ITRP
NT seq 555 nt   +upstreamnt  +downstreamnt
atgtttcgctgtgggctcgccttcccccgctgcaggtggatcgttcccctgctgctgttg
ttcgctattatttttgacatcatcgccatcgccgccaaatcgggatgggtggaggacgag
gacgccaagacccactacgccaacatgtggaacgagtggcgcggccgcgggggcaactgg
gacagcaggagcctcatggactttccatgggcccaggctgttgctgctctgatgatcatc
ggcctcatcctcctcatcatagccttcatcatagccgtggtgtccatgtgcaatattgat
gttggttgcatgtatggcacagcaacagtgctggctattgttgtggtaatccagattatt
gctctgatcatctaccctgtcaacttcaatgagcgcatttttgagggccagtacttctac
acttgggcctacggttttggctggggggccaccatcctcaccctgggctgctccatcctg
ttctgctgcctgccccagtatgaagatgacctgagaggcgaaaaaaagattaactacttt
atcactcgaccataa

DBGET integrated database retrieval system