KEGG   Oryzias latipes (Japanese medaka): 101162384Help
Entry
101162384         CDS       T02443                                 

Gene name
setd1b
Definition
(RefSeq) histone-lysine N-methyltransferase SETD1B isoform X1
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101162384 (setd1b)
Enzymes [BR:ola01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101162384 (setd1b)
Chromosome and associated proteins [BR:ola03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101162384 (setd1b)
   HMT complexes
    COMPASS/SET1 complex
     101162384 (setd1b)
    COMPASS/SET1 complex (yeast)
     101162384 (setd1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1
Motif
Other DBs
NCBI-GeneID: 101162384
NCBI-ProteinID: XP_011480129
LinkDB All DBs
Position
12
AA seq 1760 aa AA seqDB search
MSKPGERNRFNEDHGKKQSSSLANGMDSHPVCGSAEKRSHHWRSYKLIVDPALKKGSHKL
YRYDGQTFSMPNPGIPPVDMVRDPRIGRLWTKYKETDLPVPKFKIDECYIGPVPPKEVTF
ARLNDNIREGFLTDMCKKFGDIEEVEILYNPKNKKHLGIAKVVFENVKSAKVAVQSLHNT
SVMGNIIHVELDPKGENRLRYFQLLMNGSYTPKTLPVGVEEAREVSPRSLAEAILACERR
LSESSMAVVGGALPPSSSNTPLSLETGYSSLRQDTPQSQGTPHTPRQPGTPYSQDSNYSS
RQSTPAYQSGRTESSGSYKSRRHESKFQDAYNRRPERPQYRSNMYRNTPSEQSPFKQHQL
TPPEPPPSTPTFAYSAPPPATPNFKSAFSPYQTPLPPAFPPAEPAFHHPAQREGEYLRPP
QPPLPAAVDFVPVKERPETPPEPPPEPTAAPATPPPQTPERCPSPGSPVHDLERNSLDSR
IEMLLKEKRTKLLPFLEERDSDNEVQMEGSPISSSSSQLSPIPPYLGGQQNSRPCSTGLE
DISPTPLPDSEDDEPTPGVQLSAKRIGSPAADETGNSDLKNATLRGRSSTEKMESGHQSS
GEDMEISDDEMPGAPITSGDCSKDIVINSAVSPMHTHAIPPGYHPLQHQAGFAMHHHLAA
HLAAHPGVPPHMLAPISPYAPSMMPLMQMELMSRLQWSTVPMSFQMQQQMLSRMAQTRGP
YVYPHYMDSGAFAGPYQPLAMGATHANSAQEWQNPSIPKFNPTVPPPGYDGKKEDPHKAT
VDGVLLVIVKELKAIMKRDLNRKMVEVVAFRAFDEWWEKKEHSAKASLTPLKGSEGKEED
RPKPKETLGSSLLENWNKGEGLGYEGMGLGIGLRGAIRLPSFKVKRKDPPEAASASDNKR
ARPSTPVDDELEDEERDRDLTELPADESKMDADGLAKRRHSRPRVLDSEGEEEEDTSEKE
ESLSDREEGESDEVKVKDRLASGKKSGEEEDDGKDVGDSSGDSSSSDSSDDEAGSPASSK
ASSDSTSESSDSSSESSSSSEYELSSDDEDDQVSEEGRKGPRTPSSSSSSSSSSSSSEDE
GEAGVRPPSPPTGPLVEVKEEHEEREEVSSKHKRRPPSPEEVSAKDLKPTLPKVKEEDIQ
TDGGAAVGKSEPAEHAANLRPPTPTGTLPDSDQETKAKEVRSLLHPPSVPIPEFAQRARL
PTEEDIPRTPGRDLMERARGLGKSQSTDTVPITPGSDAPLTGSSLLLSSPHIPGSPFSYP
AQSPVLSAGLPRTPGRDLTFTPVFPDPAVLTLNRKISSESLDDKPVFKEPPLNSLPHQTQ
SAGSELSTSVPEDLSSDLSVDVPEPSDSTPSKKKIGRPKGKKGLAASPAHESLELSAESE
PLPPEAHLEDPSIHAISAESPKHRTLDFREEGSKPQTVLPAEDGLLSCDEDSPVVAKSTR
RSRRCWEELLRGSLSPVTTPPRSYFTRRSDFEEMTILYDIWNEGIDEEDIRLLQITYDKM
LQQDNGNDWLNDTLWVNHPPTNIPVVKKKRRDDGMRDHATGCARSEGYYKIDKKDKIKYL
QSSRLLSEEPPVDTQGMSIPAQVQASSRAGSERRSEQRRLLSSFACDSDLLKFNQLKFRK
KKIRFCKSNIHDWGLFAMEPIAADEMVIEYVGQNIRQVIADMREKRYEEEGIGSSYMFRV
DHDTIIDATKCGNFARFINHSCNPNCYAKVITVESQKKIVIYSRQPINVNEEITYDYKFP
IEDEKIPCLCGAENCRGTLN
NT seq 5283 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagccaggggagaggaacagattcaacgaagaccatggcaaaaagcagagttca
agtctggcgaacggcatggacagtcatcccgtgtgcggctcagcggagaagcggagtcac
cactggagaagttacaagttgatagtggacccggcgctgaagaagggctcccacaaactg
taccgctacgatggacagactttcagcatgcctaaccccgggatccccccggtggacatg
gttcgagacccgaggatcggtcggctctggacgaaatataaggagacggacctccctgtg
cctaaatttaagatcgatgagtgctacatcggccccgtgcccccgaaggaggtgacattc
gcccggctcaacgacaacatccgggaggggtttctcaccgacatgtgcaagaaattcgga
gacatcgaggaggtggagatcctgtacaatccgaagaacaagaaacacctgggaatagct
aaagtggtttttgagaacgtcaagtctgccaaggtggccgtgcagtcgctgcacaacacc
tcagtgatgggaaacatcatccacgtggagctggacccaaaaggtgagaaccgcctgagg
tacttccagctcctcatgaatggcagctacacgccgaaaaccctgcctgttggggtggag
gaggccagggaagtgtcccctcgcagtctggctgaagcaatactggcctgtgagcgtagg
ttgtcggagagcagcatggcggttgtgggaggggctttgccgcccagcagctccaacacg
cccctcagcctggaaacgggctactccagcctgaggcaggacaccccgcagtcccaggga
acccctcacacgccacgccagcccggtacgccctactctcaagactccaactactcgagt
cggcagtccacgcctgcgtatcagtccggccgcactgagagctctggcagctacaagtct
cgccgccacgagagcaagttccaggatgcatacaaccgcagaccggagcggccgcagtat
cgcagcaacatgtatcgaaacacgccatccgaacagtcgccctttaaacagcaccagctc
acccctcccgaacctccaccctccacacctacctttgcctactctgcacctccacctgct
acgcccaactttaagtccgccttttccccctaccagactccattacctcccgctttcccc
ccggcagaaccagctttccatcacccggcccagagggagggggagtatctcagaccgccg
cagccgcctctgccagctgcagttgactttgtaccggtcaaggagagaccagaaaccccc
ccggagccgccaccagaacccacggcggctccagctacccctcctccccaaacgccggag
agatgcccctcacccggctcccccgtgcacgatctggagcggaacagtctggactcccga
atcgagatgctcctcaaggaaaaaaggacaaagctgctgcccttcctggaggagagggac
tcggacaatgaggtgcaaatggagggaagtccaatctcctcctcatcctctcagctgtcc
ccgatcccgccttacctcggcgggcagcagaattcccgtccgtgtagcacaggcttggag
gacatcagcccgactccactgccggactcggaggacgacgagccaactcctggagtccaa
ctgtcggccaagagaatcggctctcccgccgccgacgagacgggcaacagtgacctcaag
aacgccactttacgaggccgctcctccaccgaaaagatggagtcgggtcaccagtcctcg
ggggaggacatggagatctcagacgatgagatgccgggcgctccgatcaccagtggagac
tgcagcaaggacatcgtaataaactctgcggtgtctcccatgcatacccatgccatccct
cccgggtaccaccccttacagcaccaggccggcttcgctatgcaccaccacctggccgct
cacctggccgctcaccccggggtgcctcctcacatgttggcacccatcagcccctacgcc
cccagcatgatgccgctaatgcaaatggagctgatgagccggctgcagtggagcaccgtt
cccatgtccttccagatgcagcagcagatgctgagtcgcatggctcagactagagggccc
tacgtgtatccacattatatggacagcggtgcgttcgcagggccctaccagcctctggcc
atgggcgccacgcatgccaacagtgcacaggaatggcagaaccccagtatacccaaattc
aaccccaccgttcccccgcctggttacgacggcaaaaaggaggatccccacaaggcgacc
gttgacggcgtgttgctggttattgtcaaagagctgaaggccatcatgaagagggacctc
aaccgcaaaatggtggaggtggtggctttccgagcgttcgacgagtggtgggagaagaag
gaacactcggcaaaggcgtctttgactcctctgaagggctctgagggcaaagaagaggat
cgacccaaacctaaagagacactaggctcaagcctgctggagaactggaacaagggcgag
gggctcggctacgagggaatgggtctgggaattggactgcggggcgccatccgcctgccc
tctttcaaggtgaaaaggaaagatccacctgaggctgcatctgcgagcgacaacaaacgt
gccaggccgtccacgccggtagacgacgaacttgaggacgaagaacgagatcgagatctg
accgagctccctgcagatgagtccaagatggacgccgacggcctcgccaagcgacggcac
tcccgaccccgcgtgctggacagtgagggagaggaggaggaggacacctcagaaaaggag
gagtctttgtctgacagggaagaaggagagtctgatgaagtgaaggttaaagacagactc
gcgtcaggcaagaaaagtggcgaggaagaggatgatgggaaagacgttggagactcgtct
ggagacagctcgtcctctgattcatccgatgacgaagcgggcagcccggcgtcctccaaa
gccagttccgactccacctcggaaagctccgactcctcctctgaaagctccagctcctca
gagtatgagctgagctcagacgatgaggacgaccaggtgtcagaggagggtcgcaaaggc
ccaaggacaccctcgtcttcttcctcctcctcctcctcgtcttcttcctcggaagacgaa
ggggaggcaggcgtcagaccgccgagccctcccacaggaccccttgtggaggtgaaagag
gagcatgaggagagggaagaagttagcagcaaacacaagaggagacctccaagtcctgag
gaggtgtcagccaaagacctgaagccaacgctgcctaaagtcaaagaggaggacatccag
acggacggcggcgcagctgtggggaagtctgaacctgcagaacacgcagcaaaccttcgc
ccacctactcccacagggacgctgccagatagcgaccaggagacgaaagctaaagaagtt
cgctccctcctccacccaccctctgttccaatccccgaattcgcccagcgggcccggctc
cccacagaggaggacatcccccgcacgcctggcagggacttgatggaacgggctcggggt
ctgggcaaatcccagagcaccgacacggttcccatcacacccggcagcgacgcccccctg
acgggcagcagcctgttgctcagctcccctcacatccccggtagccccttctcctacccc
gcccagtccccggtcctcagtgcagggctccctcgaaccccagggagagacctaaccttc
acccccgtcttccccgaccccgcagtgctaacgcttaacaggaaaatatcctccgaaagt
ctggatgataaacccgtgttcaaagagccccccctcaactcccttccccatcagactcag
tcggccggctccgagctctccacaagtgtcccagaagatctgtcctctgatctctccgta
gatgttcccgagccctctgacagcacgccgtcaaagaaaaagatcggccgacctaaaggc
aaaaagggcctggcggcctccccagcccacgagtctttagagctgtcagctgaatcagaa
cctctgcctcctgaagcccatctggaggatccatccattcatgcgatatctgcagagtcc
cccaaacaccgcactttggattttcgggaagaaggctccaagcctcagacggtgctgccg
gcggaggacggcctgctctcctgcgacgaggactcacctgtggtggctaagtcaacaagg
aggtcgcggcggtgctgggaggagctgcttcgagggagcctgtctcccgtcacgacgccc
ccacgctcctactttacccggcgctctgactttgaggagatgacgatcctatacgacatc
tggaacgaaggcatcgacgaagaggacatccggcttctgcagatcacctacgacaagatg
ctccagcaggacaacggcaacgactggctgaacgacacgctgtgggtcaaccaccctcct
accaacatccccgtagtgaagaaaaagaggagggacgacggcatgagggatcacgccacc
ggctgcgcgcgaagcgaggggtactataagatcgacaaaaaggacaagatcaagtacctg
cagagttcacggctgctgtcggaagagccgcccgtcgacacacagggcatgagcatccca
gcgcaggtccaagcctcttccagagctggctcggagcgccgctcagaacagcggcgattg
ctgtcctcttttgcttgtgacagcgacttgttgaagttcaaccagctgaagttccggaag
aagaagatccgattctgcaaatcaaacattcacgactggggtctgttcgccatggagccc
atagctgcagacgaaatggtgatcgagtacgtgggtcagaacatcagacaggtgatagcc
gacatgagggagaagcgttacgaggaggagggcatcgggagcagctacatgttccgggtg
gaccacgacaccatcatcgatgcgacgaaatgcggaaactttgcccgtttcatcaaccac
agctgcaaccccaactgttatgcaaaggtcatcaccgtggaatcccagaagaagatcgtg
atctactctcggcagccgatcaacgtcaacgaggagatcacctacgactacaagttcccc
atcgaggacgagaagatcccctgtctgtgtggggcggagaactgtaggggaacgctcaac
tga

DBGET integrated database retrieval system