KEGG   Oryzias latipes (Japanese medaka): 101162528Help
Entry
101162528         CDS       T02443                                 

Definition
(RefSeq) deoxynucleoside triphosphate triphosphohydrolase SAMHD1-like
  KO
K22544  deoxynucleoside triphosphate triphosphohydrolase SAMHD1 [EC:3.1.5.-]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
KEGG Orthology (KO) [BR:ola00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ola03400]
    101162528
Enzymes [BR:ola01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.5  Triphosphoric-monoester hydrolases
    3.1.5.-  
     101162528
DNA repair and recombination proteins [BR:ola03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     101162528
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HD PDEase_I
Motif
Other DBs
NCBI-GeneID: 101162528
NCBI-ProteinID: XP_011475492
LinkDB All DBs
Position
7
AA seq 501 aa AA seqDB search
MDPINPGKVFNDSIHGHVELHPLLVQIIDTPQFQRLRYIKQLGGGYFVYPGASHNRFEHS
IGVAYLAGLQAKTLKENQPKLNITDKDILCVEIAGLCHDLGHGPFSHLFDQMFMPQAHDE
DDEDDKERKVQARNKDDKEWRHEDASVEMFQYLLEKNRELLTEMKNSRLEDNDLVFIKEL
ILGEPLKKKSDKPEDPSDWPYEGRGEDKSFLYEIVSNKQNGIDVDKFDYFARDCHHLGLK
NNFDHMRYFKFTRVIGVEKNKLKRKHICSRDKEAGNLYDLFYTRDRLHRRAYQHKVTKNV
EIMIKDALLKANKHIKFKGKDKEKKENFFTISDAKDNMEAYTQLTDQVTQRILESSSSEL
EQARNILERIKTRDLYELVDEAKGQNKQHKKISKETITNELKVVLPGEVRDHHNDYFEVV
LVTYSYGKGDKDPVECSYFYKKDGEPPEAFQITRQQVSNFLPECFWEQTIRLYWKNKDKT
HWHDVAEKFTVWCEHNRFQKY
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggacccaataaaccctggcaaggtgtttaatgattccatccatggtcatgtggagtta
catccacttctggtccaaatcattgacacgcctcagttccaaagactgcgatacatcaag
cagctcggcgggggctattttgtttacccaggggcctcacacaatcgctttgaacattct
attggggtggcgtatttggcaggactgcaggcaaaaacccttaaggaaaatcaaccaaaa
ctaaacatcactgacaaagacatcctctgtgtggagattgcaggtctttgccatgacctt
ggacatggacccttttctcatctgtttgaccaaatgtttatgccacaagcacacgatgaa
gacgatgaagacgataaagaacggaaggtccaagcacgcaacaaagacgacaaagaatgg
aggcatgaggatgcttctgtagagatgtttcaatacctgctggaaaagaacagagaactt
ctgacagagatgaaaaactctaggctggaagacaatgatctggtcttcatcaaagagctt
attcttggagagcctctgaagaagaaatcagataaaccagaggatccctcagattggcca
tatgaaggtcggggagaagacaagtcatttctctatgaaattgtctcaaacaagcaaaat
ggcattgatgtggacaagtttgactactttgccagggactgccaccaccttgggctcaag
aacaactttgaccacatgcgctacttcaagtttaccagggtgattggggtggaaaaaaac
aagctaaaaagaaaacacatctgctcaagagataaggaagcaggaaatctctatgatttg
ttctatacaagagaccgcctccacagacgagcctaccagcataaagtaaccaagaacgtg
gagatcatgatcaaagatgcccttttaaaggcaaacaaacatattaagtttaagggaaaa
gataaggaaaaaaaagaaaacttcttcactatttctgatgcaaaagataacatggaggcc
tacacccaactgacagaccaagtaactcaaagaatactggagtccagtagttctgaactg
gaacaggcaagaaatattctagaaagaatcaagacacgagatttgtacgagctggttgat
gaagccaaggggcagaataaacaacacaagaaaatatctaaggagacaattacaaacgaa
ctgaaagtggtcctgccaggagaagttagagaccatcacaacgattactttgaagtggtg
ctggtcacttacagttatggcaaaggggacaaagatccagtggaatgttcttacttctac
aagaaggatggtgaaccaccagaagcatttcagatcaccagacagcaggtgtccaacttc
ctccctgagtgtttttgggaacaaaccatcaggctttactggaaaaataaagataaaaca
cactggcatgatgttgccgaaaagttcacagtctggtgcgagcacaacagatttcagaaa
tattag

DBGET integrated database retrieval system