KEGG   Oryzias latipes (Japanese medaka): 101162674
Entry
101162674         CDS       T02443                                 

Definition
(RefSeq) insulin-like growth factor-binding protein 3
  KO
K10138  insulin-like growth factor-binding protein 3
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
ola04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:ola00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    101162674
   04218 Cellular senescence
    101162674
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ola04131]
    101162674
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ola04147]
    101162674
Membrane trafficking [BR:ola04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    101162674
Exosome [BR:ola04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   101162674
SSDB
Motif
Pfam: Thyroglobulin_1 IGFBP
Other DBs
NCBI-GeneID: 101162674
NCBI-ProteinID: XP_023810164
LinkDB
Position
4
AA seq 283 aa
MPSLCVLCLAAALAAFARLAASVGPVVRCEPCDASALLQCKPPPKDCAERVREPGCGCCM
TCALGEGQACGVYTARCGSGLTCQPLSGDSRPLLALLEGRGVCTSAASTKLKSLLVPAQK
AEKLGNQMEDGANVTQTVTVFPGAATVDCGGKMVNTRPPLHDILIKKNEKKRGQSHKVEP
VAGGVNTDTHNFSLESKRESEYGPCRREMESIMSNLKITNILNPRGVRIPNCDKKGFYKK
RQCRPSKGRRRGHCWCVDKYGQPLPGYEGSKQGATQCYNLESQ
NT seq 852 nt   +upstreamnt  +downstreamnt
atgcccagtctttgcgtgctgtgccttgccgccgcgctggccgcgttcgcgcgcctcgcc
gcttcggtgggaccggtggtccggtgtgagccgtgcgacgccagcgcgctgctgcagtgc
aagccgccgcccaaggactgcgcggagagggtgagggagcccggctgcggctgctgcatg
acgtgcgccctcggagaagggcaggcgtgtggagtgtacacggcgcgctgcggctccggc
ttgacctgccagcctctgtctggggacagtcgacccctgctcgctctgctggaaggacgg
ggggtgtgtaccagcgccgcgtccacaaaactcaagagcctcctcgtgccggcgcaaaaa
gcagaaaagctgggcaatcagatggaggacggtgccaacgttacccagacagtaacggtg
ttccccggtgcggcgacagtggactgtggcgggaagatggtgaacaccaggcctccgctg
cacgacatcctcatcaaaaagaatgagaagaagaggggacagagccacaaggtggaaccg
gtggcaggaggagtcaatacagacacgcacaacttctccctggagagcaaacgggagagt
gaatatgggccgtgtcgtcgggagatggaaagcatcatgagcaacctgaaaatcaccaac
atcctcaacccgagaggcgtccgcatacccaactgtgacaaaaagggcttctacaagaaa
agacagtgtcgtccatccaaaggcaggagacggggccactgctggtgtgtggacaaatac
gggcagcctttacctggttatgagggcagtaagcagggtgctacgcagtgctacaacctg
gagagccaatga

KEGG   Oryzias latipes (Japanese medaka): 101166253
Entry
101166253         CDS       T02443                                 

Definition
(RefSeq) insulin-like growth factor-binding protein 3
  KO
K10138  insulin-like growth factor-binding protein 3
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
ola04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:ola00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    101166253
   04218 Cellular senescence
    101166253
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ola04131]
    101166253
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ola04147]
    101166253
Membrane trafficking [BR:ola04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    101166253
Exosome [BR:ola04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   101166253
SSDB
Motif
Pfam: Thyroglobulin_1 IGFBP
Other DBs
NCBI-GeneID: 101166253
NCBI-ProteinID: XP_004079417
UniProt: H2MRS7
LinkDB
Position
17
AA seq 292 aa
MMDLHVRVLCLFFLAASLTRRSGASGPVIRCEPCDAAARLSCKPLPKDCAERVREPGCGC
CMTCALSLGRRCGVYTARCGSGLTCQPQPGETKPLQALLLGLGICANSSSSSRMSLTVKP
TPVVCKLTDHAEIPDKEQTPTSSGPQTSYSTNRPAGPLKPLLHPLFSSAKADVFRQAQHK
RTQSFKMGGLPGPLITDPQNFSLQTKQEPEYGPCRREMESILSSLKMINTLNPRGLRIPN
CDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPSFGGKEQGDAQYYDFESQ
NT seq 879 nt   +upstreamnt  +downstreamnt
atgatggatctccacgtccgagtgctctgtctgttttttctagctgcatcgttaacccgg
aggtcgggtgcgagcggaccggtgatccgatgcgagccgtgtgatgctgcggcgcggctg
tcgtgcaaacctctacccaaagactgcgcggagcgggtccgggagccgggctgcggctgc
tgcatgacctgcgcgctcagcctcggccggcgctgcggcgtctacaccgccaggtgcggc
tccgggctcacctgtcagccccaaccgggtgagacgaaacctctgcaggcgctgctgtta
ggactcggcatctgtgcaaacagcagcagcagcagcagaatgtcactgaccgtcaaaccc
acacctgtggtctgtaaattgacagatcatgcagaaattccagacaaggagcagactccc
accagctcaggtcctcaaacttcctacagcaccaacagacccgcaggacccctaaagcct
ctactccaccccctcttctcctctgcaaaggcagatgtgttcagacaggcacagcacaag
agaacccagagctttaaaatggggggtctcccaggacccctcatcaccgacccacagaac
ttctctttacaaaccaaacaggagccagagtatggtccgtgtcgaagagagatggagagc
atcctcagcagccttaaaatgatcaacaccctcaaccccagaggcttacgcataccaaac
tgcgacaaaaaaggtttttataagaaaaaacagtgccgtccatcgaaagggcgaaagcgg
ggcttttgctggtgtgtggacaaatatggacagcctttgccaagctttggtgggaaggag
caaggagacgcccagtactacgactttgagagccaatag

DBGET integrated database retrieval system