KEGG   Oryzias latipes (Japanese medaka): 101162677
Entry
101162677         CDS       T02443                                 

Gene name
map2k1
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 1
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04010  MAPK signaling pathway
ola04012  ErbB signaling pathway
ola04068  FoxO signaling pathway
ola04114  Oocyte meiosis
ola04140  Autophagy - animal
ola04150  mTOR signaling pathway
ola04210  Apoptosis
ola04218  Cellular senescence
ola04270  Vascular smooth muscle contraction
ola04370  VEGF signaling pathway
ola04371  Apelin signaling pathway
ola04510  Focal adhesion
ola04540  Gap junction
ola04620  Toll-like receptor signaling pathway
ola04810  Regulation of actin cytoskeleton
ola04910  Insulin signaling pathway
ola04912  GnRH signaling pathway
ola04914  Progesterone-mediated oocyte maturation
ola04916  Melanogenesis
ola05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101162677 (map2k1)
   04012 ErbB signaling pathway
    101162677 (map2k1)
   04370 VEGF signaling pathway
    101162677 (map2k1)
   04371 Apelin signaling pathway
    101162677 (map2k1)
   04068 FoxO signaling pathway
    101162677 (map2k1)
   04150 mTOR signaling pathway
    101162677 (map2k1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101162677 (map2k1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    101162677 (map2k1)
   04210 Apoptosis
    101162677 (map2k1)
   04218 Cellular senescence
    101162677 (map2k1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101162677 (map2k1)
   04540 Gap junction
    101162677 (map2k1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101162677 (map2k1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101162677 (map2k1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101162677 (map2k1)
   04912 GnRH signaling pathway
    101162677 (map2k1)
   04914 Progesterone-mediated oocyte maturation
    101162677 (map2k1)
   04916 Melanogenesis
    101162677 (map2k1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101162677 (map2k1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101162677 (map2k1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ola01001]
    101162677 (map2k1)
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     101162677 (map2k1)
Protein kinases [BR:ola01001]
 Serine/threonine kinases: STE group
  STE7 family
   101162677 (map2k1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like Seadorna_VP7
Other DBs
NCBI-GeneID: 101162677
NCBI-ProteinID: XP_004069665
UniProt: H2LRK2 A0A3P9KEX3
LinkDB
Position
6
AA seq 394 aa
MQKRRKPEPIQLNPIPDGNTLNGTGASETNLESLQKKLEELELDEQQRKRLEAFLTQKQK
VGELKDDDFEKICELGAGNGGVVFKVSHRPSGLIMARKLIHLEIKPAIRNQIIRELQVLH
ECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQSLKKAGKIPEQILGKVSIAVIKGLSY
LREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTH
YSVQSDIWSMGLSLVEMAIGRFPIPPPDSRELEKIFGFPVEGETASSESPKPRPPGRPGS
SYGPDSRPPMAIFELLDYIVNEPPPKLPAIFSSEFQDFVNKCLIKNPAERADLKQLVVHP
FIKQSEAEEVDFAGWLCSTIGLSQPLTPTHTTTI
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgcagaagagaaggaagccagaaccgatccagctgaacccgattcccgacggaaacaca
ctgaacggaaccggagcctccgagacgaacctggagtctctgcagaagaagctagaggag
cttgagctggatgagcagcagcgaaagcgcttggaggccttccttacacagaagcagaaa
gtgggagaactgaaggacgacgactttgagaaaatctgtgagcttggtgcaggcaacgga
ggtgtcgtcttcaaggtctcgcacagaccttctggtttgatcatggcaaggaagctgatc
cacctggagatcaaaccagccatcaggaaccagatcatccgggagctgcaggttctgcat
gagtgcaactctccatacattgtaggcttctatggagctttttacagcgatggagaaatc
agcatctgcatggaacacatggacggtggctccctggaccagtctttgaagaaagcaggc
aaaatcccagagcagatccttggcaaagtcagcattgctgtcattaaagggctgtcttac
ctgcgtgagaagcacaagatcatgcacagagatgtcaaaccttctaacatcctggtgaat
tcccgaggtgagatcaagttgtgtgactttggagtgagcgggcagctgattgactccatg
gccaactcctttgtgggaactcgctcctatatgtcgccagagcgcttacagggaactcac
tactcagttcagtcagacatatggagcatgggcctgtctttagtagaaatggccattgga
cgctttcctatccctccacctgattcaagagagttggaaaagatttttgggttccctgtg
gaaggggaaacggcctccagtgaatctccaaaaccacgcccacctggacggccgggaagt
tcatatggaccagacagtagaccgccaatggccatatttgaactacttgattacatagtc
aatgagcctccaccaaagcttcctgcaattttcagctctgagtttcaagatttcgtcaac
aagtgcttgataaagaatcctgcagaaagggccgatctgaagcagctagtggtacatcct
ttcatcaagcagtctgaagcagaggaggtggactttgctggctggttgtgtagcaccata
ggactcagccagcctctgacacccacccacaccaccaccatttaa

KEGG   Oryzias latipes (Japanese medaka): 101173453
Entry
101173453         CDS       T02443                                 

Gene name
map2k2
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 2
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04010  MAPK signaling pathway
ola04012  ErbB signaling pathway
ola04068  FoxO signaling pathway
ola04140  Autophagy - animal
ola04150  mTOR signaling pathway
ola04210  Apoptosis
ola04218  Cellular senescence
ola04270  Vascular smooth muscle contraction
ola04370  VEGF signaling pathway
ola04371  Apelin signaling pathway
ola04540  Gap junction
ola04620  Toll-like receptor signaling pathway
ola04810  Regulation of actin cytoskeleton
ola04910  Insulin signaling pathway
ola04912  GnRH signaling pathway
ola04916  Melanogenesis
ola05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101173453 (map2k2)
   04012 ErbB signaling pathway
    101173453 (map2k2)
   04370 VEGF signaling pathway
    101173453 (map2k2)
   04371 Apelin signaling pathway
    101173453 (map2k2)
   04068 FoxO signaling pathway
    101173453 (map2k2)
   04150 mTOR signaling pathway
    101173453 (map2k2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101173453 (map2k2)
  09143 Cell growth and death
   04210 Apoptosis
    101173453 (map2k2)
   04218 Cellular senescence
    101173453 (map2k2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101173453 (map2k2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101173453 (map2k2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101173453 (map2k2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101173453 (map2k2)
   04912 GnRH signaling pathway
    101173453 (map2k2)
   04916 Melanogenesis
    101173453 (map2k2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101173453 (map2k2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101173453 (map2k2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ola01001]
    101173453 (map2k2)
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     101173453 (map2k2)
Protein kinases [BR:ola01001]
 Serine/threonine kinases: STE group
  STE7 family
   101173453 (map2k2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 101173453
NCBI-ProteinID: XP_004067752
UniProt: H2LJN3
LinkDB
Position
4
AA seq 397 aa
MAPKRRPVPLNITPIGEGQTTSNTIDAASEANLEALQKKLGELDLDEQQRKRLEAFLTQK
AQVGELKDEDFEPICELGAGNGGVVNKVRHKPSGLVMARKLIHLEIKPAIRNQIIRELQV
LHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEARRIPEEILGKVSIAVLRGL
AYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQG
THYSVQSDVWSMGLSLVELAIGRYPIPPPDAKELEAIFGFAILDGAEGEPHTQRPRPPGR
PVSGHGVDSRPAMAIFELLDYIVNEPPPKLPHGVFTSDFQDFVTKCLIKNPAERADLKML
MSHTFIKRSEVDGVDFAGWLCKTMTLNQPSTPTRVTE
NT seq 1194 nt   +upstreamnt  +downstreamnt
atggcccccaaaaggagacccgttcccctgaacatcacacccatcggggagggacagacc
acgtccaacaccatcgatgctgcgtccgaagccaacctagaggccttacagaagaagctg
ggagagctggacctggatgaacagcagaggaagcgtctggaggccttcctcacccagaag
gctcaggtgggagagctgaaggacgaagacttcgaacccatctgtgagctgggggcagga
aacgggggcgtggtcaacaaggtccgccacaagccctcgggtctcgtcatggcccgcaag
ctaatccacctggaaatcaaacctgccatcaggaaccagatcatcagggagctgcaggtg
ctccacgaatgcaactccccctacatcgtgggcttctacggggctttctacagcgatgga
gagatcagcatctgcatggagcacatggatggtggatccttggatcaggtcctaaaggaa
gcccggagaatccctgaggagattcttggaaaagtcagcatagcggtgttgagggggctg
gcttacctgcgggagaagcaccagatcatgcacagagacgtcaagccctccaacatcctg
gtcaactcccgcggggagatcaagctgtgcgactttggcgtgagcggccagctcatcgat
tccatggccaactcctttgtggggacgcgctcctacatgtctccggagagactgcagggg
acgcactactctgttcagtcggacgtttggagcatggggctgtccttggtggagctggcg
atcggccgctatcccatccccccacccgacgccaaagagctggaggcaatcttcggattc
gccattctggacggagccgaaggagagccgcacacgcaaaggccgagaccccccggcagg
cctgtgagcggacacggcgtggacagcaggccggccatggccatctttgaactcctggac
tacatcgtgaatgagccccccccaaaactgcctcatggtgtcttcaccagtgacttccag
gactttgtgactaaatgtttgatcaagaacccggctgagagggcagatctgaagatgctg
atgagtcacacgttcatcaagcgatcagaggtggacggcgtggactttgccggctggctg
tgcaaaacgatgaccctgaaccagccgagcacccctacccgcgtcaccgagtga

DBGET integrated database retrieval system