KEGG   Oryzias latipes (Japanese medaka): 101162681
Entry
101162681         CDS       T02443                                 

Gene name
ikbkg
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04010  MAPK signaling pathway
ola04210  Apoptosis
ola04620  Toll-like receptor signaling pathway
ola04621  NOD-like receptor signaling pathway
ola04622  RIG-I-like receptor signaling pathway
ola04623  Cytosolic DNA-sensing pathway
ola04625  C-type lectin receptor signaling pathway
ola04920  Adipocytokine signaling pathway
ola05132  Salmonella infection
ola05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101162681 (ikbkg)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101162681 (ikbkg)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101162681 (ikbkg)
   04621 NOD-like receptor signaling pathway
    101162681 (ikbkg)
   04622 RIG-I-like receptor signaling pathway
    101162681 (ikbkg)
   04623 Cytosolic DNA-sensing pathway
    101162681 (ikbkg)
   04625 C-type lectin receptor signaling pathway
    101162681 (ikbkg)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101162681 (ikbkg)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101162681 (ikbkg)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101162681 (ikbkg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ola01001]
    101162681 (ikbkg)
Protein kinases [BR:ola01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   101162681 (ikbkg)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10
Other DBs
NCBI-GeneID: 101162681
NCBI-ProteinID: XP_023812158
LinkDB
Position
7
AA seq 585 aa
MVQPQPDGPMQWDMSGEDSGGALRVPPELAGHEVVSRLLCDNQQLREALRRSNQALRLRC
EEMEGWQQRTRDEREFLSCRFQEARALVERLAQENHSLKVTANGPGSSPSSGLSCSSSQT
EDLQGRPAVNGPTDGQQTLDQWERKRADETEQRTQTTPPRSLPLEGTNDFLKLLKSHKEQ
LEETMRDLMKKNENLEREKEEGEKERDRMRRCIDQLRSKLLHTQATSGTEEVVQLRSEAQ
HSSDCSSLAKLTQQLQATQGRYRELEEKLDYLQKSSAQRDRTEALLKQKEKDCVQLAKDC
EALKAQATSLLGELQERQSCLEKSEHERKMLEEKLGSKVKALQAAERELEQQRKQHHVAV
DKLMLQSQSLEQALKVERHVVTEERKKLTQLQHAYTCLFRDYDAKLKNEGGDLSSRLDEA
EQALALKQDLIDKLKEEVEQLKGSLETVPVLTAQAEIYKADFLAEREAREKLNQKKEELQ
DQLNQAKTEIDRLNLEATSRARMEQMKLRHLDDFSTRTPLIPPPQGVFPGAGFNTVPAAP
SFRQLPVSDPGAVGTEDLPDLCCPKCQYLAPDMDTLQIHVMDCIQ
NT seq 1758 nt   +upstreamnt  +downstreamnt
atggtccagccgcagcccgacggccccatgcagtgggacatgtcaggggaggacagtggc
ggggccctcagggtcccaccggagcttgctggtcatgaggtggtgtccagattactgtgt
gacaaccagcagctcagagaggcactgcggagaagcaaccaagctctccgcctgcgctgt
gaagagatggagggatggcagcaaagaaccagagacgagcgagagtttttgagctgtcgc
ttccaggaggccagggccctcgtggagaggctggcgcaggaaaaccactcgctgaaggtc
acggcgaacggaccaggctcctccccgtcttccggtctgtcctgcagctcaagtcagact
gaagacctgcagggacgcccggctgtaaacgggccgacagatggacagcagactcttgat
cagtgggagaggaaaagagctgacgagaccgaacagcgaacacaaaccacgccccctcgc
agcctgccgttagagggaacaaacgacttcctgaagctgctgaagagccacaaggagcaa
ttggaggaaacgatgagagacctgatgaagaagaacgaaaatctggagagggagaaggag
gagggagagaaggagagggatcggatgcggcgctgcatcgaccagctgagatccaaactg
ctgcacacgcaggccacttctggcaccgaggaggtggttcagctccgctcggaggctcag
cactcgtctgactgctctagcctggctaagctcacacagcagcttcaggccacgcagggc
aggtatcgtgagctggaggagaagctggattacctgcagaagagctcggctcagcgcgac
agaactgaggcgctgctcaaacagaaggagaaggactgcgtgcagttggccaaagactgt
gaagccctgaaagctcaggcaacttccctgctgggggaactacaagaacgacagagctgc
ctggagaagagcgagcacgagcgcaaaatgctggaggagaagctaggcagtaaggtgaag
gcgctgcaggcggcggagcgggagctggagcagcagaggaagcagcaccacgtggccgtg
gacaagctgatgctgcagtcgcagagcctggagcaggcgctgaaggtcgagagacacgtg
gtcacagaggagaggaaaaaactgacacagctgcagcacgcatacacatgtctgttcaga
gattatgacgccaagctgaagaacgaaggaggagatctttccagccggctggatgaggca
gagcaggcgctggccctgaagcaggacctgattgacaaactgaaggaggaagtggagcag
ctgaaaggctctctggagacggtgcctgtcctcactgcgcaggctgagatctacaaagca
gatttcctcgcagagcgagaagcccgcgagaaactgaaccagaaaaaggaggagctgcag
gatcagctgaatcaagccaagactgaaatcgacagactcaacttggaagcaacatcacga
gcacgcatggagcaaatgaagctgagacacttagatgacttttccacacggacccctctc
attccccctccacaaggagtttttcctggtgccggtttcaacacggtgcctgcggcgccg
tccttccgtcagcttccggtcagcgatccaggagcagtgggaactgaggacttgccggat
ttatgctgtcccaagtgccagtacctggctccagacatggacacgctgcagatacatgtc
atggattgtatacagtaa

DBGET integrated database retrieval system