KEGG   Oryzias latipes (Japanese medaka): 101163032
Entry
101163032         CDS       T02443                                 

Gene name
bcl2
Definition
(RefSeq) apoptosis regulator Bcl-2
  KO
K02161  apoptosis regulator Bcl-2
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
ola04140  Autophagy - animal
ola04141  Protein processing in endoplasmic reticulum
ola04210  Apoptosis
ola04217  Necroptosis
ola04261  Adrenergic signaling in cardiomyocytes
ola04340  Hedgehog signaling pathway
ola04510  Focal adhesion
ola04621  NOD-like receptor signaling pathway
ola05132  Salmonella infection
ola05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ola00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101163032 (bcl2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    101163032 (bcl2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101163032 (bcl2)
  09143 Cell growth and death
   04210 Apoptosis
    101163032 (bcl2)
   04217 Necroptosis
    101163032 (bcl2)
   04115 p53 signaling pathway
    101163032 (bcl2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101163032 (bcl2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101163032 (bcl2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101163032 (bcl2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101163032 (bcl2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101163032 (bcl2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ola01009]
    101163032 (bcl2)
Protein phosphatases and associated proteins [BR:ola01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101163032 (bcl2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3 RELT
Other DBs
NCBI-GeneID: 101163032
NCBI-ProteinID: XP_004079404
LinkDB
Position
17
AA seq 228 aa
MANVSNRSIVEKYICHKLSKRGYVCGLNGGQRENAANNGSVGDHSPTPVRRRCDAGTGPD
EESSPRLIRALSRADPLADIHRVLREAGDELERLYQRDFTEMSRQLYLTSTTAKTRFAEV
IDELFRDGVNWGRIIAFFEFGGTVCVECASNEEMSTQVASIAEWMTEYLNGPLNSWIEEN
GGWDAFVELYDRQKETVFTCYWPSIKTVFGLAALGAASLTIGAYLAQK
NT seq 687 nt   +upstreamnt  +downstreamnt
atggcgaacgtgtctaatcgcagtattgtagaaaagtacatctgccacaaactctccaag
aggggctacgtgtgtgggctgaacggcggccagcgcgagaatgctgccaataacggctcg
gttggggaccattccccgactccggtccgccgccgctgcgacgcaggaacggggcctgac
gaggagagcagcccccgcctcatcagagcgctctcccgggcggacccgctcgcggacatc
cacagggtcctgcgcgaggcgggagacgagctggagcggctgtaccagcgggacttcacg
gagatgtcgcggcagctgtacctcacctccaccacggcgaagacgaggttcgccgaggtg
attgacgaactgttccgggacggcgtgaactggggccggattatcgcgttcttcgagttc
gggggcacggtgtgcgtggagtgcgcgtccaacgaggagatgagcacgcaggtggccagc
atcgccgagtggatgacggagtatttaaacggacctctcaacagctggattgaagaaaac
gggggatgggatgcctttgtggagctgtatgacagacagaaggaaaccgtcttcacatgc
tactggccgtccatcaagactgtcttcggcctggctgctctcggggcggcgagcctgacc
attggagcataccttgcacaaaagtga

DBGET integrated database retrieval system