Oryzias latipes (Japanese medaka): 101163032 Help Entry 101163032         CDS       T02443                                  Gene name bcl2 Definition (RefSeq) apoptosis regulator Bcl-2   KO K02161   apoptosis regulator Bcl-2 Organism ola  Oryzias latipes (Japanese medaka) Pathway ola04115   p53 signaling pathway ola04140   Autophagy - animal ola04141   Protein processing in endoplasmic reticulum ola04210   Apoptosis ola04217   Necroptosis ola04261   Adrenergic signaling in cardiomyocytes ola04340   Hedgehog signaling pathway ola04510   Focal adhesion ola04621   NOD-like receptor signaling pathway ola05132   Salmonella infection ola05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:ola00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     101163032 (bcl2)  09130 Environmental Information Processing   09132 Signal transduction    04340 Hedgehog signaling pathway     101163032 (bcl2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     101163032 (bcl2)   09143 Cell growth and death    04210 Apoptosis     101163032 (bcl2)    04217 Necroptosis     101163032 (bcl2)    04115 p53 signaling pathway     101163032 (bcl2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     101163032 (bcl2)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     101163032 (bcl2)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     101163032 (bcl2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101163032 (bcl2)   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     101163032 (bcl2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ola01009]     101163032 (bcl2) Protein phosphatases and associated proteins [BR:ola01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      101163032 (bcl2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 RELT Motif Other DBs NCBI-GeneID:  101163032 NCBI-ProteinID:  XP_004079404 LinkDB All DBs Position 17 AA seq 228 aa AA seqDB search MANVSNRSIVEKYICHKLSKRGYVCGLNGGQRENAANNGSVGDHSPTPVRRRCDAGTGPD EESSPRLIRALSRADPLADIHRVLREAGDELERLYQRDFTEMSRQLYLTSTTAKTRFAEV IDELFRDGVNWGRIIAFFEFGGTVCVECASNEEMSTQVASIAEWMTEYLNGPLNSWIEEN GGWDAFVELYDRQKETVFTCYWPSIKTVFGLAALGAASLTIGAYLAQK NT seq 687 nt NT seq  +upstreamnt  +downstreamnt atggcgaacgtgtctaatcgcagtattgtagaaaagtacatctgccacaaactctccaag aggggctacgtgtgtgggctgaacggcggccagcgcgagaatgctgccaataacggctcg gttggggaccattccccgactccggtccgccgccgctgcgacgcaggaacggggcctgac gaggagagcagcccccgcctcatcagagcgctctcccgggcggacccgctcgcggacatc cacagggtcctgcgcgaggcgggagacgagctggagcggctgtaccagcgggacttcacg gagatgtcgcggcagctgtacctcacctccaccacggcgaagacgaggttcgccgaggtg attgacgaactgttccgggacggcgtgaactggggccggattatcgcgttcttcgagttc gggggcacggtgtgcgtggagtgcgcgtccaacgaggagatgagcacgcaggtggccagc atcgccgagtggatgacggagtatttaaacggacctctcaacagctggattgaagaaaac gggggatgggatgcctttgtggagctgtatgacagacagaaggaaaccgtcttcacatgc tactggccgtccatcaagactgtcttcggcctggctgctctcggggcggcgagcctgacc attggagcataccttgcacaaaagtga

DBGET integrated database retrieval system