KEGG   Oryzias latipes (Japanese medaka): 101163356Help
Entry
101163356         CDS       T02443                                 

Gene name
pfkp
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type isoform X3
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00010  Glycolysis / Gluconeogenesis
ola00030  Pentose phosphate pathway
ola00051  Fructose and mannose metabolism
ola00052  Galactose metabolism
ola01100  Metabolic pathways
ola01200  Carbon metabolism
ola01230  Biosynthesis of amino acids
ola03018  RNA degradation
Module
ola_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101163356 (pfkp)
   00030 Pentose phosphate pathway
    101163356 (pfkp)
   00051 Fructose and mannose metabolism
    101163356 (pfkp)
   00052 Galactose metabolism
    101163356 (pfkp)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    101163356 (pfkp)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ola01009]
    101163356 (pfkp)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ola03019]
    101163356 (pfkp)
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     101163356 (pfkp)
Protein phosphatases and associated proteins [BR:ola01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101163356 (pfkp)
Messenger RNA biogenesis [BR:ola03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     101163356 (pfkp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 101163356
NCBI-ProteinID: XP_004078786
LinkDB All DBs
Position
17
AA seq 791 aa AA seqDB search
MAGNAGPKRQDTRKFVENLSGEGKCIAVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFIH
EGYQGMVDGGDNIKEATWESVSSMLQVGGTVIGSARCKEFRTHEGRLKAAHNLVQRGITN
LCVIGGDGSLTGANLFREEWSGLLNELLEQGLINEEAVSSNSVLHIVGMVGSIDNDFCGT
DMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFIPE
MPPDDGWEDNMCQKLSENRADKKRLNIIIVAEGAIDSHNKAITPDCIKDLVVRCLGFDTR
VTILGHVQRGGTPSAFDRILGSRMGVEAVLALLEASTDTPACVVSLVGNQAVRLPLMECV
QMTQEVQKAMDEKKFDEAVRLRGRSFENNLSTYRLLSYRKLDSELPNSSFNVAVLNVGAP
AAGMNAAVRSAVRVGITEGHKMFAVNDGFEGFAKGQIKEIKWGDVGGWTGQGGSLLGTKR
TLPAKRLAKIAEQMRIHNINALLVIGGFEAFESLLELYEARAHHEEFCIPMCILPATISN
NVPGTDHSLGADTSLNAIVETCDRIKQSASGTKRRVFIIETMGGYCGYLATVGGLAAGAD
TVYIYEEAFDIRDLQANVEHLTQKMKTTIQRGLVLRNENCNENFTTDFIYQLYSEEGRGV
FDCRKNILGHMQQGGAPSPFDRNFGTKVAAKAMQWITRALKESYKGGKVFTNAEDTACLL
GMRRRAMVFQPVAQLREETDFEHRIPKDQWWLKLRPLMKILAKYKTSYDVSDAGQLEHVT
RVRPKDFQPSV
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atggcggggaatgcgggaccgaagcggcaggacactcggaaatttgtggagaacctttcc
ggcgaagggaaatgcatcgcggtgctgaccagtggcggagatgctcaaggtatgaatgca
gcagtccgtgctgttgtcagaatgggcatctatgttggagcaaaggtctacttcatccat
gagggctaccaggggatggtggacggtggggacaacatcaaagaggcaacatgggaaagt
gtctccagcatgctgcaagtgggtggtacagtcattggcagcgctcgctgtaaagagttt
cgtacccatgaaggacgcttgaaagctgctcacaacctggtgcagcgcgggatcactaac
ctgtgtgtgattggtggagatggcagcttgactggagccaaccttttcagggaggaatgg
agtggcttgttgaatgagcttttggagcaaggtctcatcaatgaagaggctgtcagcagt
aactctgtgctccacattgttggcatggttggctccattgacaatgacttctgtggcacg
gacatgaccattggaaccgactcagccctgcatcggatcattgaggtggttgatgctatc
atgacaactgctcaaagccaccagaggacttttgtacttgaggtcatgggtcgacattgt
gggtaccttgcactggtcagtgctctggcatgcggagcagactgggtctttattccagaa
atgccccctgatgatggctgggaagacaatatgtgccaaaaactgtcagagaaccgcgct
gataagaaaagacttaacattattattgttgctgagggcgccattgattcccacaacaaa
gcaataacaccagattgtatcaaggacctggtggtgcgctgcttgggttttgacacaaga
gttaccattttgggtcatgtgcaaagaggtgggaccccttcagcttttgacaggatcctt
ggaagtcgaatgggtgtggaggcggtgcttgcactactggaggcgtccaccgacaccccc
gcctgcgtggtatctttggttggtaaccaggctgtgcgacttccactcatggagtgtgtt
cagatgacccaagaagtacagaaagccatggatgagaagaagtttgatgaggcggtccgt
ctgcgtggcaggagctttgagaacaacctgagcacctacagactgctttcctaccgtaaa
cttgattccgaacttccaaacagctccttcaatgtagcagtgttgaacgttggtgcaccg
gcagcaggtatgaatgctgctgtccgctctgctgtcagggtgggaatcaccgagggtcac
aaaatgtttgctgtcaatgatggcttcgagggatttgctaaaggacagatcaaggagatc
aagtggggggatgtcggtggctggacgggtcagggtgggtccctgctgggaacaaaaaga
accctacctgcgaaacgtttggctaagattgctgagcagatgagaatccataacatcaac
gctttgcttgtgattggaggatttgaggcctttgagtctctgctggagctgtacgaggcc
cgcgcccaccatgaagagttttgcattccgatgtgcattctgcccgccaccattagtaac
aatgtgcctggcaccgaccacagtctgggagcagacacatcactcaacgctatcgtagag
acgtgcgaccgcatcaagcagtctgccagtggcaccaagcggcgagtcttcatcattgag
accatggggggctactgtggttacctggccacggtgggtgggctggctgcaggcgctgac
accgtctacatctacgaggaggcatttgatatccgagacctgcaggccaacgtggagcat
ctgacgcagaagatgaagacaaccatccagagaggattggtgctgcgaaatgagaactgc
aatgaaaactttaccacagacttcatctatcagctgtactcggaggaaggacgcggcgtg
tttgactgcaggaagaacatcctcggtcacatgcagcagggaggagctccgtctcctttt
gacagaaactttggcaccaaagttgcagctaaagccatgcagtggatcacacgggccctt
aaggagtcctacaaaggagggaaagtgttcaccaacgcagaggacaccgcctgcctgctg
gggatgcggcgcagggccatggtctttcagcccgtcgctcagctccgagaggagactgac
tttgaacacaggatcccaaaggaccagtggtggttgaagctccgccccctgatgaaaatc
ctggccaagtacaagacgagctacgacgtgtccgacgccggccagctggaacacgtgacc
cgagttcggcccaaagacttccagccctccgtttga

DBGET integrated database retrieval system