KEGG   Oryzias latipes (Japanese medaka): 101163545Help
Entry
101163545         CDS       T02443                                 

Definition
(RefSeq) ribosomal protein S6 kinase beta-2
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04012  ErbB signaling pathway
ola04140  Autophagy - animal
ola04150  mTOR signaling pathway
ola04350  TGF-beta signaling pathway
ola04371  Apelin signaling pathway
ola04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101163545
   04350 TGF-beta signaling pathway
    101163545
   04371 Apelin signaling pathway
    101163545
   04150 mTOR signaling pathway
    101163545
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101163545
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101163545
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ola01001]
    101163545
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101163545
Protein kinases [BR:ola01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   101163545
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_C Kinase-like Pkinase_fungal Haspin_kinase Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 101163545
NCBI-ProteinID: XP_023810710
LinkDB All DBs
Position
1
AA seq 468 aa AA seqDB search
MAGVFDIDLETEDVSDTEDDVCDFTVTEPENVQTEEVELTSEIVNRDSERVGPDCFELLT
VLGKGAYGKVFQVRKVQGLQIGKIFAMKVLKKAKIVRNAKDTAHTRAEREILETVRHPFI
VDLLYAFQTGGKLYLILECLSGGELFMQLEKEGIFMEDTACFYLGEITLALGHLHSNGII
YRDLKPENIMLNHQGHIKLTDFGLCKESIHDGSVTHTFCGTIEYMAPEILTRSGHNRAVD
WWSLGALMYDMMTGSPPFTAENRKKTIDKILKCKLNLPPYLTIDARELIKKLLKKNPAQR
LGSGKADAADIQKHSFFKQINWDDLLNKRVEPPYKPQLHSEEDVSQFDTRFTRQTPVDSP
DDSRLSHSAELAFAGFTYVAPSVLESLKEGFSFEPKSRHMRRHNSSPHTPISPLKFSPAG
PFKAALDGEPDLFSPTSPPAAQPFVPPENGVSQPIKTPARNKKQKMRR
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggctggggtgttcgacatcgacttggagacggaggacgtcagcgacacagaggacgat
gtctgcgacttcactgtgaccgagccagagaatgttcagacggaggaggtggagctgacc
agcgagatcgtgaacagggacagcgagagagttggaccggactgctttgagctcctaacg
gttctgggaaagggagcctacggcaaggtcttccaggtgaggaaggttcaaggtcttcag
attgggaagatattcgccatgaaggtcctaaaaaaggctaagatagtgcgaaacgccaaa
gacacagcccacacgcgagcggagcgggagatcctggaaacggtgcggcaccccttcatc
gtggacctgctgtacgctttccagaccggaggaaagctctacctcatcctggagtgtctg
agcggaggagaactgttcatgcagctagagaaggaaggcatcttcatggaggacacggcc
tgcttttatctgggtgagatcactctggctctgggtcaccttcactccaacgggatcatc
tatcgagacctaaaaccagaaaacatcatgctcaaccaccaaggacacatcaagctgacg
gacttcggtctctgcaaggagtcgattcatgacggatccgtcacgcacaccttctgcggc
accatcgagtacatggctccagagatcctaacccgctcaggtcacaacagagccgtggac
tggtggagcctcggcgccctcatgtatgacatgatgacgggatcgcctccgttcacggct
gaaaacaggaaaaagaccatcgataagatcttaaagtgtaagctcaatctgcctccgtac
ctgactatcgatgccagggagctcatcaagaagctgctgaagaagaatccagcccaaaga
ctcggctctggcaaggcagacgctgcagacattcagaaacattccttcttcaagcaaatc
aactgggacgacctgctgaacaagagagtggagcctccatacaaaccccagctgcattca
gaggaggatgtgagccagtttgatacccgcttcactcggcagacgccggtggacagtccg
gacgactccaggctcagccacagcgcagagctcgccttcgctggcttcacttacgtggct
ccgtcggtcctggaaagcctgaaagaaggcttctccttcgagcccaaatcccgtcacatg
cgccggcacaacagcagtcctcacacacccatcagtcctctgaaattctcccccgccgga
cccttcaaggccgccctggacggagagccggatctattctcgccaacctctccgccagca
gcacagccttttgtcccgccggaaaacggagtcagtcagccgatcaagacgccggcgagg
aacaagaagcagaagatgaggagatga

KEGG   Oryzias latipes (Japanese medaka): 101174287Help
Entry
101174287         CDS       T02443                                 

Definition
(RefSeq) ribosomal protein S6 kinase beta-1 isoform X1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04012  ErbB signaling pathway
ola04140  Autophagy - animal
ola04150  mTOR signaling pathway
ola04350  TGF-beta signaling pathway
ola04371  Apelin signaling pathway
ola04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101174287
   04350 TGF-beta signaling pathway
    101174287
   04371 Apelin signaling pathway
    101174287
   04150 mTOR signaling pathway
    101174287
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101174287
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101174287
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ola01001]
    101174287
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101174287
Protein kinases [BR:ola01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   101174287
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_C Kinase-like Pkinase_fungal FTA2 APH
Motif
Other DBs
NCBI-GeneID: 101174287
NCBI-ProteinID: XP_004076682
UniProt: H2MA42 A0A3P9MCN2
LinkDB All DBs
Position
14
AA seq 508 aa AA seqDB search
MAGVFDIDLDQPDDNVSDDELEDGAQLGEYMEQCSSFDFNMDDCEKFELSENNVNKGTEQ
IRPECFELLKVLGKGGYGKVFQVRKVSGASSGKIYAMKVLKKAMIVRNAKDTAHTKAERN
ILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMA
LGHLHQKGIIYRDLKPENIMLNDSGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEIL
MRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKTIDKILKCKLSLPPYLTQEARDLLK
KLLKRSASSRLGGGPGDAAEVQVHPFFRHINWDDLLARKVEPPFKPFLQSADDVSQFDSK
FTSQTPVDSPDDSTLSESANQVFLGFTYVAPSVLENVKEKFSFEPKLRSPRKFPGSPRTL
LSPLKFSGGDSWLRGPLPSGNPSTVCPGSGEHPMEVSGVEQMDTSSSCTSEVSAPLPIRP
PSGIQAGPFKKQAYPMNSKRPEHLRMNL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggccggggttttcgacatcgacctggatcaaccggatgacaatgtctctgacgacgaa
cttgaggatggggctcagctcggtgaatacatggagcagtgcagcagctttgactttaac
atggatgactgcgagaagtttgaactgtcagaaaacaatgtgaacaagggaacagagcag
atccggccggaatgctttgagctgctgaaggttttgggaaaaggcggctatggaaaggtg
tttcaggttcggaaggtatcaggagccagttccgggaagatatacgccatgaaagttttg
aagaaggccatgattgtgcgcaatgcaaaggacacggcgcacaccaaagcagagagaaac
attctggaggaggtgaagcatccgttcattgtggatctcatttatgccttccagactggt
gggaagctgtacctcattctggagtacttaagcgggggggagctttttatgcagctggaa
agagagggcatcttcatggaggacacagcatgtttttatctggctgaaatctcaatggct
ctgggtcatctgcaccagaaaggcatcatctacagagacctgaagccagagaacatcatg
ctcaacgacagcggacacgtgaagctgacagactttggtttgtgcaaagagtccatccat
gatggaacagtcactcacaccttctgtggcaccatcgagtacatggccccagagatctta
atgaggagcggacacaaccgggccgtggactggtggagcctgggagctctcatgtacgac
atgctgacaggagctcctccattcacaggcgaaaacagaaagaagacgattgacaaaatc
ctaaaatgcaaactcagccttccaccttacctcacacaagaagccagggacctcctaaag
aagctgctgaaacgaagtgcctcatcacgacttggaggcggaccaggagatgctgccgaa
gttcaggtccacccgttcttccggcatataaactgggacgacctcctcgctcgcaaagta
gaacctcccttcaaaccgtttctccaatcagctgatgatgtgagccagtttgactccaag
ttcaccagccagactccagtagacagtcctgacgactccacactcagcgaaagcgctaat
caagtcttcctgggcttcacatatgtcgccccatctgtgctggaaaatgtcaaagagaag
ttctccttcgagccaaagctccgttcaccgcggaagttccctggaagccccagaaccctt
ttgagtcccttgaagttttctgggggggactcctggctccgagggccgctgccttcgggc
aatccttccaccgtttgccccggctccggggagcaccctatggaggtgtcgggagtggag
caaatggacacgagcagcagctgcacctccgaggtgtctgccccacttcccatcaggcca
ccctcaggcatccaagccgggccctttaagaagcaggcctaccctatgaactccaagcgg
cccgagcacctgcggatgaacctatga

KEGG   Oryzias latipes (Japanese medaka): 101174764Help
Entry
101174764         CDS       T02443                                 

Definition
(RefSeq) ribosomal protein S6 kinase beta-1-like isoform X1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04012  ErbB signaling pathway
ola04140  Autophagy - animal
ola04150  mTOR signaling pathway
ola04350  TGF-beta signaling pathway
ola04371  Apelin signaling pathway
ola04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101174764
   04350 TGF-beta signaling pathway
    101174764
   04371 Apelin signaling pathway
    101174764
   04150 mTOR signaling pathway
    101174764
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101174764
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101174764
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ola01001]
    101174764
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101174764
Protein kinases [BR:ola01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   101174764
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_C Kinase-like Pkinase_fungal Haspin_kinase APH Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 101174764
NCBI-ProteinID: XP_023817126
LinkDB All DBs
Position
13
AA seq 503 aa AA seqDB search
MAGVFDIDLDQPEENVSDDENEEGQHHDFMEQCSGFEFLCHGSNMDDCEQIEISEDNVNQ
GTESIRPECFELLRVLGKGGYGKVFQVRKVVGAAAGKIFAMKVLKKAMIVRNAKDTAHTK
AERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAE
ISMALGHLHQKGIIYRDLKPENIMLNSQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMA
PEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKTIDKILKCKLNLPPYLTQEAR
DLLKRLLKRTASSRLGAGPGDATEVQAHPFFRHINWEDLLARKVEPPFKPVLQSADDVSQ
FDSKFTSQTPVDSPDDSTLSESANQAFLGFTYVAPSVLENMKERFSFEPKIRSPRRIMGS
PKTLLSPGWTRSPLLPGGGRSVLQSPLEHAMELSAPEQMDVTSSSEASAPLPILQPGGVN
LAHMKQQAFPVAAKRPDHLRMNL
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggctggagtgtttgacatagatttggaccaaccagaggaaaacgtctccgatgatgaa
aacgaggagggtcagcatcatgactttatggagcagtgcagtgggtttgagttcttgtgt
cacggcagcaacatggacgactgtgaacagatcgaaatctccgaggacaatgtcaaccaa
ggaacagagagcatcagaccagagtgcttcgagctgctgcgggttctggggaagggtggt
tacggaaaggttttccaagttcgtaaagttgtcggagctgcagctggcaaaatatttgcc
atgaaagttttaaaaaaggcgatgattgtacgcaacgcaaaggacacagcccataccaag
gcagagaggaacatcctggaggaggtgaagcatcccttcatcgtcgacctcatctatgcc
ttccagacgggagggaagctgtacctcatcttggagtacctgagcggaggagagctcttc
atgcagctggagagggagggcatcttcatggaggacacggcctgtttttacctggcagag
atttcaatggccctgggtcacctgcaccaaaagggcatcatctacagagacttgaaacca
gagaacataatgctcaacagtcaaggtcacgtcaagttgacagactttgggttgtgtaag
gagtccattcacgatggcacggttacgcacaccttctgcggcaccatcgagtacatggct
ccagagatcctgatgagaagcggacacaaccgagcggtggactggtggagtctgggtgct
ctgatgtacgacatgctcacaggagcgcctccgttcacaggagagaaccgaaaaaagacc
attgataaaatcctgaagtgcaagctcaacctgccaccctacctcacacaggaagcccga
gacctcctcaaacggttgctgaagagaactgcttcatcacgactgggggcggggcctgga
gatgccacagaagtgcaggctcatcctttttttcgacacatcaactgggaggatttgctt
gcccggaaagtggagcctcccttcaagccggtgctgcaatcagcagatgacgtgagccag
tttgactcaaagttcaccagccaaacgccggtcgacagcccagatgactccaccctcagt
gagagtgccaatcaagccttcctgggtttcacatatgtggctccatcggttttagaaaac
atgaaggagaggttttcctttgaaccaaagatccgctctcctcggcggatcatgggcagt
ccaaaaacacttctcagccccggctggacccgaagccctcttcttcccggcggagggcgg
agcgtccttcagtctcctctggagcacgccatggagctgtccgcaccggaacagatggac
gtcaccagcagctccgaggcctcggcacccctccccatccttcagcccggcggggtcaac
cttgcccacatgaagcagcaagccttccccgtcgccgccaaacggccagaccatcttcgt
atgaacctatga

DBGET integrated database retrieval system