KEGG   Oryzias latipes (Japanese medaka): 101163574
Entry
101163574         CDS       T02443                                 

Definition
(RefSeq) G1/S-specific cyclin-D2-like
  KO
K10151  G1/S-specific cyclin-D2
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04068  FoxO signaling pathway
ola04110  Cell cycle
ola04115  p53 signaling pathway
ola04218  Cellular senescence
ola04310  Wnt signaling pathway
ola04340  Hedgehog signaling pathway
ola04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101163574
   04340 Hedgehog signaling pathway
    101163574
   04068 FoxO signaling pathway
    101163574
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101163574
   04115 p53 signaling pathway
    101163574
   04218 Cellular senescence
    101163574
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101163574
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 101163574
NCBI-ProteinID: XP_004071272
UniProt: H2L8M5
LinkDB
Position
8
AA seq 314 aa
MDRGMCVSLWCEEVEDDAAQDQGQGEDQAQGCTGGSPQLRAAWDPTVSGHRVIQRLLHLE
ERYMPSMLYTTLIQRDPERREELAKWALEVCCDCGCDEAVFPRSVSLMDRFLSASLSLAV
SPYCLAAGCVLIASKLTECDGVTADSLCAAAEYSFQPSDLREMERVILSTLRWDTAAVTP
QDFLPHFLASVGEQGDAEREMLSTLRRHSDTLAAMCACDSRFLGAPPSLVAAASLNCALR
GLSNKGPTQLSKSSEALAELCQTDLVVLQCYSEMIESALRQRLRGGLQQPPMEKDEEMEN
ERPGTPTDMREINF
NT seq 945 nt   +upstreamnt  +downstreamnt
atggacagaggaatgtgcgtgtccctttggtgtgaggaagtggaggacgatgcagcccag
gatcagggacagggtgaagatcaagcccagggatgtacagggggctcgcctcagctgcgt
gccgcctgggaccccacagtgtcaggtcatcgagtgatccaaaggctgcttcacctggaa
gagaggtacatgccctccatgctttacaccaccctcatccagcgggatccagagcgcagg
gaggagctcgccaaatgggccctggaggtatgctgcgactgcggttgtgatgaggccgtg
ttcccccggtctgtgtctctgatggacaggttcctgtctgcatctctgtctctggctgtg
tctccatactgcctggctgctggctgcgtcctgatcgcctcaaagctcacagagtgtgac
ggcgtgactgcagacagcctctgcgccgcagctgagtacagcttccagccgtcagacctg
cgggagatggagcgtgtcatcctcagcactctccggtgggacaccgcggcagtcacaccg
caggacttcctccctcactttctggcctctgttggggagcaaggtgacgctgagagggag
atgctttcgactttgcgccggcacagcgacactctggctgccatgtgtgcctgcgactcc
cgttttctgggagctcccccatcacttgttgccgcagcatcactaaattgtgccctaagg
ggtctgagcaacaaggggcccactcagctgtccaaaagcagtgaagctctggcagagctg
tgccagactgatctggtagtcctgcagtgctacagcgagatgatcgaaagtgccctcagg
cagcggctgaggggtggactgcagcagccccccatggagaaggatgaagagatggagaac
gaaagacctggaacaccaactgacatgagagagatcaatttctaa

KEGG   Oryzias latipes (Japanese medaka): 101165722
Entry
101165722         CDS       T02443                                 

Definition
(RefSeq) G1/S-specific cyclin-D1-like
  KO
K10152  G1/S-specific cyclin-D3
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04110  Cell cycle
ola04115  p53 signaling pathway
ola04218  Cellular senescence
ola04310  Wnt signaling pathway
ola04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101165722
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101165722
   04115 p53 signaling pathway
    101165722
   04218 Cellular senescence
    101165722
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101165722
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 101165722
NCBI-ProteinID: XP_011472921
LinkDB
Position
5
AA seq 316 aa
MMEGFVPGLDAENTPKMRTVVVIRAGTDPTVTGDLRVLLNLRALEGASPDSRCASEQRDI
QPYMRRILTVWMFKVCEEQLCEQEVFPLAVHYLDSYLKRFCIEKSSLQLLGTVCMFVASK
MRETVPLTASKLAIYTDNSISTADILQWEVMVVSRLGWCLASVVPSDFLEPILQALPFVH
PLNIQNMRRHVHSYIALAAMDCRFSAFLPSTLACACVTAAVQTLAAGNSPDSVMKLLSDL
LAADLSSVMGCHKLLASVLDVSLPPCFQGGVGRSNTNSSGFRCISADAKDTNCPSLENLT
QRVEGNEMSEGGKPKK
NT seq 951 nt   +upstreamnt  +downstreamnt
atgatggagggtttcgttccgggtttagatgcagaaaatactccaaaaatgcggactgtg
gtggtaattcgggcggggaccgacccaaccgtcaccggagacctccgagtcctcctcaac
cttcgagccctggaaggggcgagcccggactcccgctgcgcttccgagcaaagagatatc
cagccctacatgaggaggatcctcaccgtgtggatgtttaaggtgtgtgaggagcagctc
tgtgagcaggaggtgttccccctggcggtacattatctggactcctacctcaaacgtttc
tgcatagagaagtccagcctgcagctcctgggaacagtctgcatgtttgtggcctccaaa
atgagagagacggtccccctcacagccagcaagctcgccatctacactgataactccatc
tccactgcagacatcctgcagtgggaggtgatggtggtgtccaggttagggtggtgtctg
gcctccgtggttccttcggactttttggagccaattcttcaagctctcccctttgttcac
cccctcaacattcagaacatgcgcagacatgttcactcctacattgccctggcagccatg
gactgcaggttctcggccttcttgccctccactcttgcgtgcgcttgtgtcaccgccgct
gtgcaaacattggcagccggcaactctccagattctgtgatgaagcttttgtccgacctg
ttggcggcagatttgagctcggttatgggctgccataaactgctggccagcgtgttggac
gtcagcctgcctccgtgtttccagggtggtgttggcaggtcaaacacaaacagttcaggg
ttcaggtgcatctctgctgatgccaaggacaccaactgcccctcattagagaacctaacc
cagagggttgaaggaaatgaaatgtctgaaggcgggaaacccaaaaaatga

KEGG   Oryzias latipes (Japanese medaka): 101169672
Entry
101169672         CDS       T02443                                 

Gene name
ccnd1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04068  FoxO signaling pathway
ola04110  Cell cycle
ola04115  p53 signaling pathway
ola04218  Cellular senescence
ola04310  Wnt signaling pathway
ola04340  Hedgehog signaling pathway
ola04371  Apelin signaling pathway
ola04510  Focal adhesion
ola04530  Tight junction
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101169672 (ccnd1)
   04340 Hedgehog signaling pathway
    101169672 (ccnd1)
   04371 Apelin signaling pathway
    101169672 (ccnd1)
   04068 FoxO signaling pathway
    101169672 (ccnd1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101169672 (ccnd1)
   04115 p53 signaling pathway
    101169672 (ccnd1)
   04218 Cellular senescence
    101169672 (ccnd1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101169672 (ccnd1)
   04530 Tight junction
    101169672 (ccnd1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 101169672
NCBI-ProteinID: XP_020567270
LinkDB
Position
3
AA seq 292 aa
MEEQLLCCEVDSIRRAHQDVNLLNERVLRTMLKAEENYLPAPNYFKCVQKDIAPNMRKIL
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSVEPTRKSRLQLLGATCMFLASKMKETVPLT
AEKLCIYTDNSVQPGELLQMELLVLSKLKWDLASVTPHDFIEHFLSKLTIHASTKQILRK
HAQTFVALCATDVNFIASPPSMVAAGSVVAAVQGLYLKSQDASLSSQNLTNFLSQVIRSD
PDCLRSCQEQIESLLESSLRQAQQHGSVTEAKRVDEEVDLSCTPTDVRDINI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaggagcagctgctgtgctgcgaggtggactccatccggagagcccaccaggacgtc
aacctgctgaacgagcgcgtcctgcggaccatgctgaaggcggaggaaaactacctgccg
gcgcccaactacttcaagtgtgttcagaaggacatcgctcccaacatgaggaagattctg
gccacctggatgttagaggtctgtgaggaacagaaatgcgaggaggaggtttttccgttg
gcaatgaactatttggacagatttttatcagtggagcccaccaggaaaagcagactccag
ctgcttggagctacatgcatgtttctggcatctaagatgaaggagacggtaccattgact
gcagagaaactctgtatctacacagacaactcggtccaacctggagaactgctgcaaatg
gagctgctggttctcagcaagctgaaatgggatctggcttctgtcacacctcatgacttc
atcgagcacttcctgtccaagctgacaatccacgcatcgacaaagcagatcctcaggaaa
cacgcccagacctttgtggctctctgcgctacagatgtgaactttatagccagtcctcca
tcaatggtggcagccggcagtgtggtggcagctgttcaaggactctacttgaaaagccaa
gatgcctccttgtcctctcagaacctgactaacttcctgtctcaggtcatccgcagtgac
ccggactgtttgcggtcgtgtcaggagcagattgagtctctgctggagtccagcctgcgg
caggcgcagcagcatggcagcgtgacggaagccaagcgtgtggatgaagaggtggacctg
tcctgcacgccaacagacgtgcgggacatcaacatttga

KEGG   Oryzias latipes (Japanese medaka): 101174910
Entry
101174910         CDS       T02443                                 

Definition
(RefSeq) G1/S-specific cyclin-D2
  KO
K10151  G1/S-specific cyclin-D2
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04068  FoxO signaling pathway
ola04110  Cell cycle
ola04115  p53 signaling pathway
ola04218  Cellular senescence
ola04310  Wnt signaling pathway
ola04340  Hedgehog signaling pathway
ola04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101174910
   04340 Hedgehog signaling pathway
    101174910
   04068 FoxO signaling pathway
    101174910
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101174910
   04115 p53 signaling pathway
    101174910
   04218 Cellular senescence
    101174910
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101174910
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Vel1p K-cyclin_vir_C
Other DBs
NCBI-GeneID: 101174910
NCBI-ProteinID: XP_004069887
UniProt: A0A3B3I2H1
LinkDB
Position
6
AA seq 299 aa
MELLCLEMETNIRARPDPNLLCDDRVLQRLLTIEERFLPQYSYFKVVQKDIQPFMRRMVA
TWMLEVCEEQKCEEEVFPLAMNYLDRFLAVVPTKKCNLQLLGAVCMFLASKLKETRPLTA
EKLCIYTDNSIRPQELLEWELVVLGKLKWNLAAVTPNDFIEHIVRRLPLPEDKLALIRKH
VQTFIALCATDFRFAMYPPSMIATGSVGAAICGLQLDSADQSQWGDSLTDLLAKITNTEV
DVLKECQEQIECVLESSLREGRQQQQQQQQQQTQRGPSGKGLDELDQSSTPTDVRDVNL
NT seq 900 nt   +upstreamnt  +downstreamnt
atggagctgctctgcctcgaaatggaaaccaacatcagagcacgtcccgacccgaacctc
ctgtgcgatgacagagtcctgcagaggctgctgaccatagaggagaggtttctacctcaa
tattcatatttcaaagtcgtccagaaagatattcagccgtttatgaggaggatggtggcc
acttggatgttggaggtttgtgaggagcagaagtgcgaggaagaggtttttcctttggcc
atgaactatttagacagatttttagcagtggtaccaaccaaaaagtgcaacctgcagctg
ctgggagcagtctgcatgtttctagcctccaaactgaaagagacacgtccattaactgca
gagaagctttgcatctacacagataactccattagaccacaagagctgctggaatgggaa
ctggtggttttggggaagttgaagtggaacttggcagcagtaacgccaaacgactttatc
gagcacattgtgaggaggctgccgctacccgaggataagctggcacttatacgtaaacat
gtccagaccttcatcgccctctgcgccacagatttcagatttgccatgtaccctccctcc
atgattgccacaggaagtgtgggggctgcgatctgtggcctacagctggactcagccgac
caatcacagtggggagacagtctgacggacctgctggccaaaatcacaaacacagaagtg
gacgttctcaaagagtgccaggagcagatcgagtgcgtgctggagagcagcctacgtgag
gggcggcagcagcagcagcagcagcagcagcagcagactcagagagggcccagcggcaaa
ggcctggacgagctggaccagtcctccaccccgacagacgtccgcgatgtcaacttgtga

KEGG   Oryzias latipes (Japanese medaka): 101175697
Entry
101175697         CDS       T02443                                 

Definition
(RefSeq) G1/S-specific cyclin-D2
  KO
K10151  G1/S-specific cyclin-D2
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04068  FoxO signaling pathway
ola04110  Cell cycle
ola04115  p53 signaling pathway
ola04218  Cellular senescence
ola04310  Wnt signaling pathway
ola04340  Hedgehog signaling pathway
ola04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101175697
   04340 Hedgehog signaling pathway
    101175697
   04068 FoxO signaling pathway
    101175697
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101175697
   04115 p53 signaling pathway
    101175697
   04218 Cellular senescence
    101175697
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101175697
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 101175697
NCBI-ProteinID: XP_004083130
LinkDB
Position
23
AA seq 294 aa
MDLYCLESDIVVKAQPDPNILYDERVLQSLLTIEDSFLPQCSYFQRVQKDIHPYMRRMVA
GWMHEVCEGEKTNEDVFPLAINYLDRFLAVVPTRKNFLQLLGAVCMFLASKLKDCRPISA
ETLCMYTDFSITPRELLEWELVVLGKLKWNMASVIPNDFIEHIMRRLPIPKDKLALVRKH
TQTFIALCATDDRLAMNPPSMIATGSMAAAICGLQIYHTDQRLNRDNLTDLLAKITNTEV
DCLRACQEQIERVLASSLQQGQQHRQESGVRAGSKAREQQDQSSTPTDVRDVNL
NT seq 885 nt   +upstreamnt  +downstreamnt
atggatctttactgcttggagtcggatatagtcgtgaaagcccagcctgacccaaacatc
ctttatgatgagagagttttgcaaagtttattaacaattgaggacagttttttaccccaa
tgctcgtattttcagcgggtccagaaggatattcacccttatatgagacgaatggttgca
ggttggatgcacgaggtgtgtgagggagagaagactaatgaagatgtctttcctttagct
attaattatttggacagatttttagccgtggttcccacaagaaagaactttttgcagctt
ctgggagctgtgtgcatgttcctggcctccaagctgaaggactgcaggcccatatcagca
gagacactctgcatgtacactgacttctccattacaccaagggaactgctggagtgggag
ctggtggtgctggggaagttgaagtggaacatggcctccgttatccccaatgattttata
gagcacatcatgcgcaggctgcctattcccaaagacaagttagcgttggtccgaaagcac
acgcagacttttatcgctctttgtgctacagatgaccggctcgccatgaacccgccctct
atgatcgccacaggcagcatggccgccgccatctgcggcctgcagatctaccacactgac
cagcggctgaatcgagataacctgacagacctgctggccaagatcaccaacaccgaggtg
gattgtttgagggcctgccaggagcagatagagcgtgttctggcctccagcctgcagcag
ggccagcagcaccggcaggagagcggcgtcagagccggcagcaaggcgagggagcagcaa
gatcagtccagcacccccacagatgtgcgtgacgtcaacttatga

DBGET integrated database retrieval system