KEGG   Oryzias latipes (Japanese medaka): 101163630Help
Entry
101163630         CDS       T02443                                 

Definition
(RefSeq) pancreatic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00500  Starch and sucrose metabolism
ola01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101163630
Enzymes [BR:ola01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     101163630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 101163630
NCBI-ProteinID: XP_004085115
UniProt: H2N0D4
LinkDB All DBs
Structure
PDB: 

Position
17
AA seq 512 aa AA seqDB search
MKLFVLIALFGLGFAQHNPNTRDGRTAIVHLFEWRWADIAAECERFLGPKGFAGVQISPP
NEHILVSSPWRPWWQRYQPISYNLCSRSGGENELRDMITRCNNVGVNVYVDAVINHMCGA
GGGEGTHSSCGSWFNANNKDFPSVPYSNLDFNDGKCKTGSGNIENYGDPYQVRDCRLVGL
LDLALEKDYVRGKVADFMNKLIDMGVAGFRVDACKHMWPGDLDNVYRRLNNLNTKWFPGG
SRPFIFQEVIDLGGEPITTGEYVGLGRVTEFKYGARLGELFRKWNGQKLSYTKNWGEGWG
FMADGNAVVFTDNHDNQRGHGAGGASILTFWDPRLYKMAVGYMLAHPYGFTRVMSSYSWD
RNFVNGKDENDWIGPPSNGDGSTKPVPINPDQTCGDGWVCEHRWRQIMNMVQFRNVVNGQ
PHANWWDNGNNQVAFGRGNRGFIVFNNDDWALDVTLNTGLPGGTYCDVISGNKDGGSCTG
KQITVGGDGRAHFYINNSEEDPFIAIHADSKL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttttcgttctgatcgctttgttcgggctcggcttcgcccagcacaaccccaac
accagggatgggaggacagccatcgtccacctgtttgagtggcgctgggctgacattgct
gcagagtgcgagcgcttcttgggtcccaaaggcttcgctggtgtccagatttctccacca
aatgagcacatcctcgtgagcagtccttggagaccctggtggcagagataccagccaatc
agctacaacctctgctcaagatctgggggcgagaatgagctgagagacatgattaccaga
tgcaacaatgttggggtcaatgtctacgtggatgccgtcatcaaccacatgtgtggagct
ggtggtggagagggaacccactcctcctgtggcagctggttcaatgctaacaacaaagac
ttccccagtgtcccttattctaacttggacttcaacgacggcaaatgcaagactggaagt
ggcaacatcgagaactacggggatccttaccaggtgcgtgactgccgtctggttggcctt
ttggacctggctcttgagaaagattacgttcgagggaaggtggcggatttcatgaacaaa
ctgattgacatgggagtggctggattccgagtggatgcctgtaagcacatgtggcctggc
gatctggacaacgtttaccgccgtctcaacaacctgaataccaaatggttccccggcggc
agcagaccctttatcttccaggaggtgattgatctcggaggtgagcccattacaaccggc
gagtatgttggtcttggaagagtgactgagtttaaatacggtgccagactgggagaactc
ttcaggaagtggaatggacagaagctgtcttacactaagaactggggagaaggttgggga
ttcatggctgacggcaatgctgttgtctttaccgacaaccatgacaaccagagaggccac
ggcgcaggaggagcctccatcctcaccttctgggatcccagactttacaagatggccgtc
ggatacatgctggctcatccttacggatttacccgagtcatgtctagctacagctgggac
cgcaactttgtgaacggaaaggatgagaatgactggattggaccccccagcaacggtgac
ggatccaccaagccagttcccatcaaccctgaccagacctgtggagatggatgggtgtgc
gagcacagatggcgtcagattatgaacatggttcaattccgtaacgtggtcaatggacag
cctcatgccaactggtgggacaacggcaacaatcaggttgcctttggccgcggtaaccgt
ggattcattgtgtttaacaatgatgactgggctctggatgtgactctcaacactggcctg
cccggcggcacctactgcgatgtcatctctggcaacaaggatggaggcagttgcactggg
aagcagatcactgttgggggagacggccgtgcccatttctacatcaacaactcagaagaa
gatcctttcattgctattcatgctgattctaagctgtga

DBGET integrated database retrieval system