KEGG   Oryzias latipes (Japanese medaka): 101163764Help
Entry
101163764         CDS       T02443                                 

Gene name
setd2
Definition
(RefSeq) histone-lysine N-methyltransferase SETD2 isoform X1
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101163764 (setd2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ola03036]
    101163764 (setd2)
Enzymes [BR:ola01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101163764 (setd2)
Chromosome and associated proteins [BR:ola03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101163764 (setd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET WW AWS
Motif
Other DBs
NCBI-GeneID: 101163764
NCBI-ProteinID: XP_023819883
LinkDB All DBs
Position
16
AA seq 2587 aa AA seqDB search
MDIVAKSEIREEGSGASVKVEGLSKSALIKSLSPRVILSNHLLPKGTKMRVNLEDQGRQK
VSFSFAQTKKPLQSPLFIPASNDTPVTEPQGALSQSSSDRAGKSTDGKAEQKQTLLVATS
VTEIPSPTSVSSSTRLKTNVAKMHFKKQILNVSTVEKPASVSSEELHTSESQKLTSKSEG
GFPMPQPQKSGSLSENAQTELLGTKESPISRKPAASQAKDSDSSSSTDRDNVYKRVTRSQ
LDSAPHASETDGESAHVSSRRQSADSKSKTNSDSRDKVKKSSSSSHVGEREKSSSKRSEN
HERSSSYSKSDRDSRNTSSRSSRLEKDRRRSRSRSGSRSRGARTSSSYARSERYRSDRGS
RSERSYYHESDRRSHRSSPRRERRLSHSRPDRTRESSHSDEDHKRTRTTDSTRSSHHLNS
YKESKSSSSKSDKSSKSVDSSQSSEFDKRSQSSKSERTSKRSDSDSQHKYSPVSDLSYRK
SSSHHKSETNDNTSCSVHTQSKTHEKHHKSSSSDSEGKLHPTDKSTTSSDKCKELEKESK
RPESKETDPYRSPMKSPKHDCQPNGINALSSATISETFPQSEKAQSNLQPERNRHSHQDA
KKIAASTDKVFQESLSREDQEEKSELEIAITARESLNPENITLDNLYTVKECFSSNDQPH
PDHDAAGLHLCKSGESIICKQGENVSDLHPKSSSDEPATQNVIQNTKLEIDKPNEVLALE
NQASKSETLEPDPSCLTNEGQQVKAQSNVDAAKKSSCSSRKSRWDIVGQDIFESDVLQKA
GYPESSPAVKTTRFFNNICHDSEIQQELATLMTLTKQGQISEQEVSLDTITYKYKDQNEP
SQASTTIYHCDLKPTARQTPTNSEEMMHMMDKQQILSFTTQSWNGEGQESEPKENTEKSK
LSKQAPARQDVLGKQSEGSDSDISEYDSDCDKAIKQLHSVVVVPNNSSLTKDAKHREVSP
RHAENLSALSTACLPAWGNTNEVPNQIHSKQTGQSGLSDSLISSVLCQSQSNMIDSTSHS
EGASFMSTQPFFAVNDGTHGQATASIQTSDIFKKVGLELRQHPIPSQDQQVFLYYQREDP
STADRINDNNRFPVGWDFSQSEQPTSTYQQPDSSHGSLLTNTKVTGAASIGPEPRHAVAS
CTQQPPNMQTIKKLYLQEHYQESSSEIHPDSLTNDHDDYSGDKLSSSQVDSLNTPGSSSF
VQAHEISSNSRGSAVPDPSRDDTFRPHRGRGPPKKRRPEVESDSDNEAEVGPSSKRERQR
ETEVSKETLVKAEAQRPPLSLHDFQDAQKWKEFARSKKMPPYFDLIEENLYLTERKKSKS
HRDIKRMQCECPVLSREERGKGVMACGEDCLNRLLMIECSSRCLNGAYCSNRRFQMKQHA
DFEVILTDDKGWGLRAAKEMAPNTFVLEYCGEVLDHKEFKTRVKEYARNKNIHYYFMSLK
NNEIIDATLKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKAVAAGTELTFDYQFQR
YGKEAQKCFCGAPSCRGFLGGENRVSVRAAGGKMKKDRNRKSALTTVDEELEALLENGEG
LCDEKQVVSLCRLMVRVETMEQKLICLKLIQNTQNPSCLKQFLDHHGLSLLWIFMVELSE
AKGNSATGIKMQIEIMKTLAVLPISTKNMLEESKVLTLIQRWAQTKTLPQQTEMDGYSSE
NTSRAQTPLNTPDGSSSKLGPELDSEASKPAVYRRLKIISENSLDSALSDASKASDGKEE
EEDEEDEEEDEPMQGDPTEGKELKVEAADATKESTLESVADNDSGKQEELEMSGTSEQQP
QSLTVETKSDSDVKMEDFEMKEDTAEDQRDPQQEVPSDEQDGSEKQINLTLAEKPDLEVD
QPNVSESQSSQEGADDLPAEQPSETLEVCEELQEADKPPPPPPPPPPPPPSQTDPHPGES
TTDVSPSSETTEATVPPEVTATAVEASAVGTPSQDEEEGLSDVESERSQEPQHNVLDISS
MAARLLETWKDLKEVYRIPKKSQVEKEARNRSRDRDTGLKPRTTSGSRERERERERERER
ERERDRDRDRDYEKDRDRDWDRDRERDRDRISDKTPRSSERRRRRSLSPPPSSYERSSRR
TEERFDLSNSKTPRVVSSKERNKLSTEERRKLFEQEVAQREAQKQQQQQQQQLQQQQQQL
QTMVYDPALAYVSSPSFITYPPGYPIQTFVDPSNPNAGKVLLPTPPVDYEQTPPLASAGL
VSEIGIPSPSSSSQTTPVSNLTQHITTTNIATGTPQQYAQPNVATQDTGVAVLSVPPQPA
TQVQSQQSYTTLWDPTTQQAVTVQTQPAQQYAAAAGQAQPQAAIYYQGQPCQAIYSIPAA
YPQANPPVIQAYTEPTASYLHGQAVYPSHQQGVVVQQGGTVTTIVTSQTVQPEMIVPSNV
IDLPPPSPPKPKTIVLPPNWKVARDPEGKIYYYHIVTRQTQWDPPTWEGSSDSTSVDHES
EMDLGTPTYDENPSKFSTKTAEADTSSELAKKSKETFRKEMSQFIVQCLNPYRKPDCKSG
RISNTEDFKHLARKLTHGVMNKELKACKNPEDLECNENVKHKTKEYIKKYMQRFGTVYRP
KEDTDVY
NT seq 7764 nt NT seq  +upstreamnt  +downstreamnt
atggacattgtggccaagtcagagatcagagaggaagggagtggtgcttcggttaaagtg
gagggtctgtccaagtcggctttaattaagagtttgtctcccagagtcattctgtccaac
caccttttgccaaaagggaccaagatgagggtaaatttagaagaccagggtcgccagaaa
gtgtccttcagcttcgcacagacaaagaagcctttgcaaagtccgctcttcatccctgcc
agtaatgatacgcctgtcaccgaacctcaaggtgccttgtcgcagtcgagctcagacaga
gcagggaaaagtacagatggcaaagctgagcaaaagcagacactgttggtggcaacatct
gtaacagagataccttctccaacatcggtctccagctccaccagactcaaaacaaacgtg
gcaaagatgcacttcaagaaacaaattcttaacgtgtcaactgtagagaaacctgcgtct
gtttcatcagaagagctgcacacatcagaatcgcagaagttgacaagcaaaagtgaaggt
ggctttccaatgccgcagcctcagaagtctggtagtctatcagaaaatgctcaaacagaa
cttttggggacaaaagaaagcccaatctcgaggaaaccagcggcttctcaagcaaaagac
agtgacagttccagcagtactgatcgggataatgtttacaaaagggtaaccaggtcacaa
ttggatagtgctccccatgcctcagaaactgatggagagtcagctcatgtgtcttccagg
cgtcaatctgcggattcaaaaagcaaaactaactccgacagcagagacaaagttaaaaag
tcttcctctagttcacatgttggggaaagagaaaaaagttcctctaaacgatcggagaat
catgaaaggtcatctagctactctaagtcggaccgtgactctagaaatacatcttcacgc
tcatcacgattagaaaaagatcgaagaaggtccaggtctagatccggatctagatcaaga
ggggctcggacaagttcatcctatgccagatcggagagatatagaagcgacagaggatct
cgctctgaaaggtcgtactatcatgaatctgatcggcgatcacacaggagttctccccgc
agagaaagaagactttctcactcccgtccagacagaacacgagagagttctcattctgat
gaggaccacaaacgaacgagaacaacagactcaactaggtcatcccaccatttaaactcc
tacaaagaatccaaatcatcctcttccaagtctgataaatcctctaaatcggtggattct
tctcagtcctctgaatttgacaaaagatcacaatcatcaaagtctgaaaggacttcaaaa
agatcagactctgattctcaacacaagtactctccagtttcggatttgtcataccgaaaa
tctagcagtcatcacaagtcagagaccaatgataatacatcttgtagcgttcatacacag
tctaaaacacatgaaaaacaccataaaagcagctccagtgactctgagggaaaactacac
cccactgacaaaagtaccacctcttcagataaatgtaaagaacttgaaaaggagagcaaa
aggccagagtcaaaagagacagacccctatagatctcccatgaaatcccctaaacatgac
tgccaaccaaatggcatcaatgctctgtcatctgcaaccatctcagaaactttccctcaa
agtgaaaaggcgcaatccaatcttcaaccagaaagaaacaggcatagtcatcaggatgct
aaaaaaatagctgcatccactgacaaagtctttcaagaatccctgtcaagggaggatcaa
gaagaaaaatctgaacttgaaatagctataacggcgcgtgaaagcctgaaccctgaaaac
atcactttagacaatttgtacactgtgaaggaatgcttctcctccaacgaccaaccacat
cctgatcacgatgcagctggacttcatttatgcaagagtggggagagtatcatttgcaaa
caaggtgaaaatgtttcagatctccatccaaagtcctcttctgatgaacctgccacacag
aatgttatacaaaacactaaattggagattgataaaccgaatgaagtgttggcacttgag
aaccaagcatctaaaagcgagacacttgaacccgatccatcgtgtcttacaaatgaaggt
cagcaggtgaaggcacagtcaaatgttgatgctgcaaaaaagagtagttgctccagcaga
aagtctaggtgggatattgttgggcaggacatttttgagagtgatgtcttgcaaaaagca
ggttatccagagagtagtcctgctgtcaaaacaaccagattttttaacaacatttgtcat
gattctgaaatacaacaagagcttgctacactaatgacactgaccaaacaagggcagatt
tctgaacaggaagtcagtttagacaccataacctataagtacaaagaccaaaatgagcct
tcacaagcaagcaccaccatttatcactgtgacctaaaacctactgctcgtcaaacacca
acaaactcggaggagatgatgcacatgatggacaagcaacagatcttgagttttaccacg
caaagctggaacggtgaaggccaagaaagcgaacccaaggaaaacacagagaaaagcaaa
ctgagtaaacaagcaccagccaggcaggatgtattaggaaaacagagtgaaggaagcgac
agcgacatctcagagtacgactctgattgtgataaggctataaaacagttgcattctgtc
gtagtggtgccaaataactcttctctgacaaaagatgcaaagcatagggaggtgtctcca
cgtcatgctgaaaatctttcagctctgtccactgcatgcctaccagcttgggggaatacc
aacgaagtcccaaatcaaattcactccaaacaaacaggacagagcggtttgagtgattct
ctcatcagcagtgtgttgtgtcagtctcagagcaatatgatcgatagcaccagtcactcg
gaaggggccagtttcatgagcacccagcctttttttgctgttaatgatggcacccatgga
caagccacagcttctatccaaacttcggatattttcaaaaaggtcgggctagagcttaga
caacatcctatacctagtcaagatcagcaggtgttcttgtattaccagcgtgaagatcct
tctactgctgaccgtattaatgacaacaacagattccctgttggttgggacttttcccag
tcagaacagccaactagtacgtaccagcagcccgatagcagccatgggtctttgttaaca
aacactaaggtgacaggagcggcatccattggcccagagcccagacatgctgttgcttcc
tgcacgcaacagcccccaaacatgcagactatcaaaaaactctacctccaggaacattat
caggaatcttccagtgaaatccatcctgactctctcactaacgaccatgatgattacagt
ggggataaactgtcatccagtcaagtagattcactaaacactccaggttcatcaagcttt
gtgcaagcccatgaaataagcagcaacagcagaggctctgcggtacccgacccctccaga
gatgacactttcaggcctcacaggggtagaggccctccaaagaagaggcgtcctgaagtg
gagtcagactcggacaacgaggctgaagtgggaccctcaagcaaaagggagcgtcagagg
gaaacggaggtctccaaggaaacactcgtaaaagctgaggcgcagcgaccaccgctcagt
ttgcatgactttcaagatgcccaaaaatggaaagaatttgccaggtctaaaaagatgccc
ccctactttgacttgattgaagagaacctgtacctgactgagagaaagaagagcaaatct
catagagacatcaagaggatgcagtgcgagtgtccagttctgtccagagaggagcgcggg
aaaggagtcatggcatgtggggaggactgtttgaacaggctgctgatgattgaatgctca
tcacggtgcttgaatggagcgtactgctctaaccgccggtttcaaatgaagcaacacgca
gactttgaggtcattcttaccgacgacaaaggctgggggctgcgcgcagctaaagagatg
gctccgaacacgtttgtccttgaatattgtggcgaggtgctggaccacaaagagttcaaa
acgagggtgaaagaatacgctcgcaacaaaaacatccactactactttatgtctcttaaa
aataatgaaatcattgatgcaacattgaaggggaactgctctcggtttatgaaccacagc
tgtgagcctaattgtgaaacccaaaagtggactgttaatggccagcttcgggttgggttc
ttcaccaccaaagcagtcgctgcagggactgagctgacgtttgactaccagtttcagaga
tacgggaaagaagcacagaaatgcttctgtggagctcccagctgcagaggcttcctcggc
ggggagaacagagttagtgttcgtgcagctggagggaagatgaagaaagaccggaaccga
aagagcgctcttaccacggtggatgaggagctggaggccttactggagaatggagaaggc
ctgtgtgatgagaaacaggtggtttctctctgcagactgatggttcgagtggaaacaatg
gagcagaaactcatttgtctcaagctcatacagaatacccaaaatccatcatgcctcaaa
cagttcctggaccatcacggcttgtctctactgtggatttttatggtggagctctccgag
gcgaagggcaacagtgccacaggcatcaaaatgcagatagagattatgaaaaccttggct
gtgcttcccatctcaaccaagaacatgctggaggagagcaaagttctaaccctcattcag
cgctgggctcaaaccaaaactctcccgcagcagacggagatggatggttactccagcgag
aacacgtcccgcgcccaaaccccactcaacactcctgatggttcctccagcaaactgggg
ccagagttggacagcgaagcctccaagcctgctgtgtaccgccgtctgaaaatcatcagc
gagaacagcctcgacagcgcgctttccgacgccagtaaagcatctgacgggaaagaggag
gaggaggatgaagaagacgaggaagaagatgaaccaatgcaaggagatccaactgaagga
aaggaattgaaggttgaagctgcggacgcgacaaaagaatcaacactcgagtctgtggcg
gataatgatagcgggaagcaggaagagctggagatgagtggaacaagcgagcagcagcct
caaagtctgactgtagaaacaaaatctgattctgatgtgaaaatggaagactttgagatg
aaggaggacactgctgaggatcagagagaccctcagcaggaagttcctagtgatgaacag
gatggttcagagaagcagataaatctgactttggcagaaaagcctgatttggaagtagac
cagccaaatgtgtcagaaagccagtccagccaagaaggtgctgatgatctcccagctgag
cagccctcagagactttggaggtgtgtgaagaattacaagaggcagataaacctcctccc
cctcctcctccacccccaccgcctcctccttcacagactgatccccaccctggtgaatct
actactgatgtgtctccaagctcagagaccacagaggcaaccgtgccccctgaagtcact
gcaacagctgtggaagcctcagctgtaggaactccttctcaggatgaagaggaaggcctt
tccgatgtggagagtgaaaggagtcaagagccccaacataatgttttggacataagcagc
atggctgccaggctgctggaaacgtggaaagacctgaaggaggtctacaggataccaaag
aagagtcaggtggaaaaagaagcaagaaatcgcagtcgggatcgagacacgggtttaaag
ccacgcaccacatcaggcagccgagagcgtgagagggagcgtgagagggagcgggaaagg
gagcgggaacgagacagagaccgggatagagactatgaaaaagacagggatcgagactgg
gacagggacagagaacgggaccgtgacagaatctcagacaaaactccacgcagctctgag
cgacggaggaggcgctccttgtctccaccaccttcttcttatgagaggagcagccggcgc
acagaggagcggtttgatttatcaaacagcaagacaccaagagtagttagcagtaaggag
cgcaacaagctgtccacggaggagcgcaggaagttatttgaacaggaagttgctcagcgg
gaagcccagaaacagcaacaacaacaacagcagcagcttcagcagcagcagcagcagctc
caaaccatggtttacgatcccgctctggcttacgtgtcaagccccagcttcatcacctac
cctcctggatacccaatccagacctttgtggacccctccaaccccaacgccggcaaagtc
cttcttcccactcctccagttgactatgaacagaccccgcctctggcctctgctggcctt
gtctctgaaataggcataccttcaccctcctcctcttcccaaaccactccagtctcaaat
cttacccagcacatcaccaccaccaacatcgccaccggtaccccccagcagtacgcccag
ccaaatgtagccacccaggacactggggtagctgtactctctgtgccaccccagccagcc
actcaggtacagagccagcagagctacaccaccctctgggatcccaccacccaacaggca
gtgactgtacaaacacagccggcacagcagtatgctgcagctgcaggacaggctcagcca
caggcagccatctattaccagggccagccatgccaggctatctacagcatccctgctgcc
tacccccaggccaatcctccagtcattcaggcttatactgaacccacagccagctacctg
catggtcaggcggtgtatcctagtcaccagcagggggtggtggtgcagcagggtggaaca
gtaaccaccattgtgacgtcccaaactgtacaaccggaaatgattgtgcccagcaatgtg
atagaccttcctcctccctctccccccaagcccaaaactatcgtcctacctcccaactgg
aaagtggctcgggaccctgaaggaaagatctactactaccatattgtcactaggcaaacg
cagtgggatccacccacttgggaaggaagcagtgacagcacgagtgtggaccatgaatct
gagatggacctgggaacacccacctatgatgagaatccttctaagttttccaccaaaacg
gcagaagctgacacttccagtgaactggctaagaaaagcaaagagacatttcgaaaggag
atgtcccagttcatagtgcaatgtctgaatccgtatcgtaaaccagactgcaaatctgga
cgcatcagcaacactgaagattttaaacacctggccaggaagctcactcatggagttatg
aataaggaactgaaagcctgcaagaacccagaagatcttgaatgcaacgagaatgtgaag
cacaagaccaaggagtacatcaagaagtatatgcagagatttggcaccgtgtacaggccc
aaggaggacacagacgtgtactga

DBGET integrated database retrieval system