KEGG   Oryzias latipes (Japanese medaka): 101163871
Entry
101163871         CDS       T02443                                 

Gene name
ei24
Definition
(RefSeq) etoposide-induced protein 2.4 homolog isoform X1
  KO
K10134  etoposide-induced 2.4 mRNA
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    101163871 (ei24)
SSDB
Motif
Pfam: EI24
Other DBs
NCBI-GeneID: 101163871
NCBI-ProteinID: XP_004084645
UniProt: H2MWE7
LinkDB
Position
14
AA seq 346 aa
MTDSVRTFLHNVATGVKDSILGIGTISKLDSRIQQKRQEQRKKRTIGALAKRRVQTDEHK
PDNDPRVASRIFQCCAWNGGVFWLSLFLFYRVFIPLLQTLTAKIIGDPSLHGSVWSWLEF
LLTSVFSALWVLPLFVLSKIVNAIWFQDIADLAFEVSGCKAQPFPSVSKIIADMLFNLLL
QALFLIQGMIVSLFPIDAIGQMVSLLHMSLLYSLYCFEYRWFNHGIEMHQRLSNIERNWP
YYFGFGLPMALLTAMPSSYIISGCLFSILFPLFIISANEARTPTKLYHFQLRLFSLVVLI
SNKLFHKTVHLQSSLTLSGSSEKLSSSHISPKPPKNAVHPMLHPLE
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgacagacagtgtcaggacgtttctgcacaacgttgctacgggggtcaaggattccatt
ttggggattggaacaatttctaagttagattcgcggattcaacaaaaaaggcaggagcaa
cgaaagaaaagaactattggtgcccttgcaaagagacgggtacaaactgatgaacacaaa
ccagacaatgatccaagggtagcaagcaggatttttcagtgctgtgcctggaatggagga
gtcttctggctcagtctttttctgttctaccgggtgtttattcctctgctacagactctc
actgcaaaaatcattggtgacccctcccttcatggcagtgtatggtcttggctagagttc
ctcttgacttctgtctttagcgcactctgggttctccctctgtttgttctcagcaagata
gtaaatgccatctggttccaggacatagctgaccttgcatttgaggtgtctggctgcaaa
gctcagcccttccccagtgtcagtaagattattgcagacatgctttttaaccttcttctt
caagcgctcttcttaattcagggtatgattgttagtctatttcccattgatgcgattgga
cagatggtgagcctccttcacatgtctctgctgtactctctgtactgctttgagtatcgc
tggttcaaccatggcattgaaatgcaccagcggctttccaatattgagaggaactggccc
tattactttggttttggtttacccatggccctgctcactgctatgccttcttcatatatt
atcagtggatgcttgttctccattctatttcctctttttatcatcagtgcaaatgaagca
aggacaccaacaaagctgtaccattttcagctgcgactcttctctctggttgtgctcatc
agtaacaaactttttcacaagacggtccatctgcaatcctctcttacgttgtcaggatca
tcagagaagctctcctcatcccacatctcccccaaaccgccaaagaatgctgtccaccca
atgctgcatcctcttgaataa

DBGET integrated database retrieval system