KEGG   Oryzias latipes (Japanese medaka): 101164532Help
Entry
101164532         CDS       T02443                                 

Gene name
tmprss3
Definition
(RefSeq) transmembrane protease serine 3
  KO
K09634  transmembrane protease serine 3 [EC:3.4.21.-]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
KEGG Orthology (KO) [BR:ola00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ola01002]
    101164532 (tmprss3)
Enzymes [BR:ola01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     101164532 (tmprss3)
Peptidases [BR:ola01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101164532 (tmprss3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR DUF1986 SRCR Ldl_recept_a Trypsin_2 DotU
Motif
Other DBs
NCBI-GeneID: 101164532
NCBI-ProteinID: XP_023806242
LinkDB All DBs
Position
21
AA seq 481 aa AA seqDB search
CSCSADNDVEKSWRSRLFPHRLELLVAACLLLAVAFFFSVGLGVGLSCVGRFRCGSSQKC
VASSARCDGAADCPNQEDELGCVRLSGRRSVLQVQRRGEWRTVCADNWNNSLGLSACKQL
GYSRYVESSFVPQNSIEEDLQSSLVSLDTTQSDVIKLQSAAAFRYADRQDKGESQCSSGM
VTTLKCLECGSRPRYQTRVVGGNLSLPGQFPWQASLHFRGEHMCGGSVISPLWIVTAAHC
VYGFSNSSLWKVYVGLTEQPIHAAQSLAVRKIVYHARYRSRSLDYDIALMRLDQPLTFNG
LVEPICLPNHGEDFQEDTKCWISGWGATEEDGESSVVLRAAVVPLISTRTCNQPEVYAGH
ISSWMICAGYLEGGVDSCQGDSGGPLACHDPSAWKLVGATSWGEGCAARNRPGVYTRVTT
ALSWIRKQMEVSAEGGHEGGSKVVQRTDRVSSEPSRTMTLQSSADPPTAEIWGFWCEFVE
P
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
tgttcttgttctgcagacaatgatgtggagaagagctggaggagccggctgttcccccat
cgtctggagctgctggtggcggcgtgcctcctgctggccgtggcgttcttcttcagcgtg
ggtcttggagtggggctgagctgcgtgggccggttccgctgtggttcctcgcagaagtgc
gtcgcctcctcggcccggtgcgacggagcggcggactgccccaaccaggaggacgagctg
ggctgtgtccggctgagcggcaggaggtccgtcctgcaggtccagagacgaggagaatgg
agaaccgtctgcgcagacaactggaacaactcgctgggactctccgcctgcaagcagctg
ggatactccaggtatgtggagtcgtccttcgtccctcagaactccattgaagaagacctt
cagagcagcctggtgtccttggacacgacgcagtctgacgtcatcaagcttcagagcgcc
gcggccttcaggtatgcagaccggcaggataaaggtgagagtcagtgcagctccgggatg
gtgaccacgctgaagtgtctggagtgcggctccaggcctcggtaccaaacccgcgtggtg
ggggggaacctgtcattgccgggtcagttcccctggcaggctagtctccactttaggggg
gagcacatgtgcgggggctcggtcatctccccgctgtggatcgtcaccgcggcccactgc
gtgtacgggttcagcaactcgtccctgtggaaggtttacgtggggctgacggagcagccg
atccacgccgctcagtctctggctgtgaggaagatcgtttaccacgcccggtaccggtcc
agaagcctggactacgacatcgctctgatgagactggaccagcctctcacgtttaacggt
ctggtggagcccatctgcctccccaaccatggggaagacttccaggaggacaccaagtgc
tggatctccggctggggagcaacggaggaggacggagagagcagcgtggttctgcgcgct
gccgtggttcccctcatctccaccagaacctgcaaccagccagaggtctatgcgggccac
atctcatcctggatgatctgtgcaggatacctggaggggggggtggactcctgtcagggc
gacagcgggggcccgctcgcctgccacgacccgtcggcgtggaaactggtgggagcgacg
agctggggggagggctgcgccgccaggaacaggcccggcgtttacacgcgcgtcaccacg
gcgctcagctggatccgcaagcagatggaggtcagtgcagagggtggccatgaggggggg
tcaaaggtcgtccagaggaccgaccgggtctcctcagaaccgtccagaaccatgacgctc
cagagttcagctgacccccccacagctgagatctgggggttctggtgtgagtttgtagaa
ccatga

DBGET integrated database retrieval system