KEGG   Oryzias latipes (Japanese medaka): 101164831Help
Entry
101164831         CDS       T02443                                 

Gene name
si
Definition
(RefSeq) sucrase-isomaltase, intestinal
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00052  Galactose metabolism
ola00500  Starch and sucrose metabolism
ola01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101164831 (si)
   00500 Starch and sucrose metabolism
    101164831 (si)
Enzymes [BR:ola01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     101164831 (si)
    3.2.1.20  alpha-glucosidase
     101164831 (si)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 101164831
NCBI-ProteinID: XP_023817356
LinkDB All DBs
Position
13
AA seq 1823 aa AA seqDB search
MGKRRFSSMEVTLLVLFVLMTATAVTMIALYFTREPKSIQDETNEGFIPVCPNVAQAERV
DCFPETGASQLTCEQRGCCWSPLDTPNVPWCFFSSNHGYTAHSVKHPNPHEITAELSRMP
SPSLFGADIQQLSFHAEMQTSNRLRFKIFDAQQKRFEVPHEHINTVTSNPSTPISDALEI
TNEPFGLIVRRKENKKVLFDTTFAPLVFADQFLQLSAKLPSHNIYGLGEHVHQNYRHDTN
WRTWPIFSRDAFPNGGTHNLYGHYPFFLCLEDNSGNSFGVFLLNSNAMEVTLQPAPAVTY
RTIGGILDFFIFFGETPEQVVQEFEELIGRPVIPPYWSLGFQLSRWNYGSLSEVKKTVER
NRAVGLPYDIQYTDIDYMEEKKDFTYDKVNFKDLPTFADYLHEKGQKYILILDPAIATSK
LIGDVAYGSYDRGTAKNAWVTESDGKTHLVGEVWPGETVFPDYTSQNCIDWWVDEYDRLY
KEVKHDALWIDMNEVANFKQGSSKGCSVNKLNYPPYTPRILDDLMYSKTLCMDAKQAWGN
HYDVHSLYGYSMVLATEQALQRVFGGNRTLMLTRSSFPGVGKYSGHWLGDNGANWNDIKW
AIPGMLEFGLFGVPYIGADICGFFDDSSEELCRRWMQVGAFYPFSRNHNAEGYKPQDPAS
YGASSLLVATSKHYLSIRYTLLPYLYTLFYKAHTSGDTVVRPLLHEFYSDSDTWAVDRQF
LWGKYLLITPVLDPGVESVQGYFPDAVWYDYETRERLGQRKTHVELFLPADKLGLHIRGG
AILPTQEPDVTTTHSRLRPMGLIIALDDNNQATGELFWDDGDSRATVENGKYIHYDFSVV
DNVLAMDVTNAGYSDPNNLKFETITVLGVPHAPSAVFVIHIGPGGASDPVEIKNTSIHHD
ATKEVLTLNDLSLTLGESYKVQWDSVTLDYQRVDCHPEENSNEAECKKRGCLWEVSAAEN
VPWCFYPDDYGYNVLNYAETTTGIRVDINRNTRYRSSGRPDSPDIDSLRVEINYHTGDML
QFKIWDPSTERFEVPVPLTVPSTPESDEDKRLYRVSVTESPFGIQVVRKSTGTTVWDSSM
PGFIFSNMFIQISTKLSSKFVYGFGETEHTSFKHDLDYHTWGMFAKDQPPGYKMNCYGVH
PFYMGLENTGDAHGVLLLNSNAMDVTFQPTPSLTYRTIGGILDFYMVLGPTPEMVVQEYT
SLVGRPVLPAYWSLGFQLCRYGYANDSEIENLYTDMKKAGIPYDVQYADIDYMERQLDFV
LDSEFQGLPALVDQMRAEGMRFIFILDPAISGNETNYPAFERGVAQDVFIKWPKELGDGI
VWGKVWPDFPNVTVDEDLDWETQVQIYRSYAAFPDFFRSQTAAWWHQEIQDFYTNVMKFD
GLWIDMNEPASFVHGTVGGTCLGENLLEFPPYMPPLESKEEGLKHKTLCMNSEQILSDGK
RVKHYDVHNLYGWSHTKPTYDALLDVTGKRGIVVTRSTYPSSGKWAGHWLGDNNSSWDQL
YKSIIGMMEFSLFGIPYTGADICGFFNEADYEMCLRWMQLGAFYPYSRNHNGKGNPRQDP
VAWDDRFATISKDVLNIRYTLLPYLYTLMFEAHTQGSTVVRPVLHEFTNDKTTWDIHRQF
LWGPALLISPALDAGQTVVNGYLPVARWYDYHSAQDVGVRGKWLTMQTPLERINLHVRGG
YILPWQKPESNTKLSRKNPLGLIVALSDSGTAEGSFFWDDGEGIDTVEQKKYLHATFSTA
SNTLTNKVVHNGLNPEDRLTLGSVKVWGTGTEKITEVTLTDSTGKIHQVIPQQNIYTQEL
IIDVTVLAVYLDLPFTIEWKSVV
NT seq 5472 nt NT seq  +upstreamnt  +downstreamnt
atggggaaaaggcggttctccagtatggaggtgaccctcctggtcctctttgtgttgatg
actgcaacagctgtcaccatgatcgctctgtacttcacaagagaacctaaatccatccaa
gatgaaacaaatgagggattcattcctgtttgtccgaacgttgctcaggctgagagggtg
gactgttttcctgaaactggagcatcacagctgacgtgtgagcagcgcggctgctgctgg
agccctctggataccccaaatgttccctggtgctttttctcatccaaccatggttacaca
gcgcactcagtgaaacacccaaatccccatgagatcacagctgagctgagcagaatgccc
tctccatctttgtttggtgcggatatacagcagctgtcattccacgccgaaatgcagaca
agcaatcgtcttcgatttaagatatttgatgcccagcagaagaggtttgaggtacctcat
gaacacatcaacaccgtcacaagtaacccatcgacccccatcagcgatgcactagaaatc
actaatgaacccttcggcctcattgtgcgcagaaaagagaacaaaaaagtcctgtttgac
actacatttgcaccactggtttttgcagaccagttcctccagctgtctgccaagcttcca
tctcataatatttatggtcttggtgaacatgtccatcagaactatcgccatgacacaaac
tggaggacttggcccatttttagcagagacgccttccccaatgggggaacccataacctt
tatggacattatcccttcttcctctgtctggaagataacagtgggaactcttttggggtt
tttcttctgaacagcaatgctatggaggtgactctgcagcctgccccggctgtgacctac
aggaccatcggtggaatccttgacttcttcatttttttcggagaaacaccagaacaagtt
gtgcaggagtttgaagagttgatcggccggccagtcatccctccctactggtcgctgggt
ttccagctgtcccgctggaactacgggagcctgagtgaggtcaagaaaacagtggagagg
aaccgtgcagtgggacttccatatgacatccagtacactgatatagactacatggaggaa
aagaaagatttcacctatgacaaggtgaacttcaaagacctgcccacatttgctgactac
ctgcatgagaagggccaaaagtacatcctcatcttggatcctgccatagccaccagtaag
ttgataggagatgttgcatacggatcatacgatcgtggaactgcgaagaatgcctgggtc
acagaatcagatgggaaaactcatttagttggagaggtctggccaggagagacagtattt
ccagattataccagccaaaactgcatcgattggtgggtggatgagtatgatcgactttac
aaggaggtcaaacacgacgctctgtggattgacatgaatgaggtggctaatttcaagcag
ggatcaagtaagggctgcagtgtcaacaagctaaactaccctccttacactccaaggatt
ttagatgacctgatgtacagtaagaccttgtgcatggatgcaaagcaggcctgggggaac
cactatgatgtccacagtctgtatggctactctatggtgctggctactgaacaagccctg
cagcgagtgtttggaggaaaccgcaccctgatgctgacccgctcctcctttccaggagtt
ggaaaatactcaggtcactggctgggagacaacggagccaactggaatgacatcaaatgg
gccattcctggcatgctggaatttggtctgtttggagtcccctatatcggtgctgacatt
tgtggattctttgatgattcatccgaagagttatgtcgtcgctggatgcaagtgggggct
ttttatccatttagccgaaaccacaacgccgagggctacaagccccaggacccagcttca
tacggtgcatcctctctcctggtcgcgacatccaagcattacctgagcatacgctacacc
ctcctgccttacctctacacactcttctacaaagcgcacacttcaggagacaccgttgta
cgacctctcctgcatgagttctactctgacagtgatacctgggcggtggaccgccagttt
ctttggggaaagtacctgctcatcacaccggtgctggatccgggtgtggaaagcgtgcag
ggatatttcccagatgctgtgtggtacgactatgagacgcgggagcggctcggacaacgc
aaaacacacgtggagctgtttctgccagccgataagctcggcctacacattagaggcggg
gcaattctcccaacgcaggaacctgacgtcaccaccacacacagccgactcagacccatg
gggttgattatcgctcttgatgacaacaaccaggcaactggggagctattctgggacgac
ggagattcaagagcaaccgttgaaaatggcaaatacatccactatgacttctctgttgtc
gataacgttctggcgatggacgtgacgaacgccggctatagcgacccaaacaaccttaag
tttgagaccatcactgtcctcggggtgccccatgctcccagcgccgtctttgtgattcat
attggccctggaggggcttcggaccctgtcgagataaaaaacaccagcattcatcatgat
gcaaccaaggaggtgctgacgctgaatgacctcagcttgactctaggagaaagctacaaa
gtgcagtgggattctgtgacattggattatcaacgtgtggactgccatccagaagaaaat
tcaaatgaggctgaatgcaagaagagaggctgtctgtgggaagtaagcgctgctgaaaat
gttccgtggtgcttttatccagatgactacggctacaacgttttaaactatgcagaaact
actacaggcatcagagttgatatcaatcggaacacgaggtacagaagcagtggtcgtcca
gattcaccagacatcgatagcctccgtgtagagattaactatcataccggtgacatgctc
caatttaagatctgggatccaagcactgagcgttttgaggttcctgtgccgctgacggtt
ccttctactcctgaaagtgacgaggacaagaggctgtacagagtttctgtcaccgaaagt
ccatttggtatccaggttgtaaggaaaagcacaggaaccacagtctgggactcttccatg
ccaggttttatcttctccaatatgttcattcaaatatcaaccaaactgtcatccaagttt
gtctatgggtttggggagaccgaacacaccagcttcaagcatgacctcgactaccacacc
tggggtatgttcgccaaggaccagcctccaggatacaagatgaattgctatggagttcat
cctttctacatggggctggagaacaccggcgacgctcacggtgtgctgctgctcaacagc
aatgccatggatgtgacattccagcccactccatccttaacctaccggactattggaggc
atcctggatttctacatggtcctgggacccactcctgagatggttgtgcaagaatacact
agtctggttggacgacctgttttacctgcttattggtcccttgggttccaactctgtcgc
tacggttacgccaatgactcagaaatagaaaacctttatactgacatgaaaaaagcggga
ataccttacgatgtccagtatgcagatattgactacatggagcgtcagctggactttgtg
ttggactcagagtttcaaggacttccagctctcgtagaccaaatgagagcagagggcatg
cgattcatcttcattctggatccagccatttccgggaatgagacaaactatcccgctttt
gagagaggagtggctcaagatgtcttcatcaaatggcctaaagagcttggtgatggaata
gtatggggaaaggtctggcctgatttcccaaatgtaacagtggatgaagatcttgactgg
gaaactcaagtgcagatttacagatcttatgcagcatttccagacttcttccgctcgcaa
acagcagcctggtggcatcaagaaatccaggatttttataccaatgtaatgaagtttgat
ggcctttggattgacatgaatgagcctgccagttttgttcatggcacagtaggagggaca
tgtcttggagagaatcttctagaatttcctccatatatgccacccctggagagcaaggaa
gaaggcttaaaacacaagaccctctgcatgaacagcgagcaaattctcagtgatggaaag
agagtcaagcactatgatgtgcacaacctgtatggatggtcccacaccaaacccacctac
gatgccttgctggatgtgacgggtaaaaggggcattgtggtgaccagatccacctacccc
tccagtgggaaatgggcaggacattggctgggtgacaacaattccagctgggaccaactt
tacaaatctattattggtatgatggagttcagcctgtttggcattccctacactggagca
gacatttgtggcttctttaacgaagctgattatgagatgtgccttcgttggatgcagttg
ggcgctttctatccatactcacgcaaccacaatggcaagggtaaccctagacaagaccct
gtcgcttgggatgacagatttgccaccatatccaaggacgtcttgaacatccgttacacc
ttgttgccctatctgtacacattaatgtttgaggcacatacccaaggaagcaccgttgtc
agaccagtgttacatgagtttacaaatgacaaaactacatgggacatccatagacagttc
ctctggggacctgccctacttatcagtccagctctagatgcgggacaaacggtggtcaat
ggctaccttccagttgcacgctggtatgactaccactctgctcaagatgtcggggtccgt
ggcaagtggttaaccatgcagacaccccttgaacgtatcaaccttcatgtcagagggggc
tacattttgccctggcagaaaccagagagcaatacaaaattgagccgaaagaatcctcta
ggactgatcgttgccttgagtgacagtgggactgctgaaggatcattcttctgggatgac
ggagaaggcatagacacggtggagcagaagaagtatctccatgcaaccttttccacggca
tcgaacactttgaccaacaaagttgtccacaatggtctgaatcctgaagatcgcctgact
ctgggttcggtgaaggtctggggcacaggcactgaaaagatcactgaagtcactctgaca
gactccactgggaagattcatcaagtgattccacagcagaacatctacactcaggagctg
atcattgatgtcacagtgctggctgtttatttggatcttccttttaccatcgagtggaag
tctgttgtctga

DBGET integrated database retrieval system